KEGG   Phaeodactylum tricornutum: PHATRDRAFT_46264Help
Entry
PHATRDRAFT_46264  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     PHATRDRAFT_46264
Protein kinases [BR:pti01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   PHATRDRAFT_46264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 386 aa AA seqDB search
MSLSSALQASLKHDATEIIKKWSLRSLADHGIEGVTASNSKLILSEATKRLAHQHEACVR
ILEIVKEIKSRQDNILNSEAAFVCQRAISNLESLRYVHADTYKLGSEIVGNQNIWNRFSK
SDKHLLHSTAEQLRSRHARSIETMVQIVSDIRNIDGDETQVDSHVDEFLQGRLGVQLLCD
HYVRLYKGSPNGGVSVNCLLADAISDAVTEASHMCDAHLQIFPETLLPEPGLRLTIVRPW
IHHALVELLKNAMAASVAKANRDSKNEVDPVRINLGEDDEMILIDIVDEGTGIEQEFEEV
FMLGHSTAVKRWDRLDEQQSYAAVRSPLSSLGVGLPTSRWMIEYFRGSLELWNNKDISTG
PSKGCTSRLRLYRDPNILEQEPRIRR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgtcctcggctctgcaggcgtcactgaagcatgatgcaacagaaataataaag
aagtggtcgctgcgatctctggccgaccacggaattgagggggtcacggcatcgaattcc
aaattgatactttcggaagccaccaagaggctagcacatcagcacgaagcgtgcgtccgc
atccttgagatcgtcaaagaaatcaaatcccgtcaagataacatattgaactccgaagca
gctttcgtgtgtcaacgagctatttccaatttggagagtcttcgatatgtgcacgccgac
acatacaagcttgggagcgaaatcgttggcaaccagaacatatggaaccgattttccaag
tctgacaaacatcttttgcactcaactgccgagcagctgagatcgagacacgcgcgaagc
atcgaaacgatggtacaaattgtatctgacatccgaaacatagatggcgatgaaactcaa
gtcgattcacatgttgacgagttcctacaaggacgactgggtgtgcagcttctttgcgac
cattacgttagactttacaaggggagtccgaatggaggcgtgagcgttaactgcttgtta
gcagatgctatttcagatgccgtgactgaagcatctcatatgtgcgatgcgcatttacag
atatttccagaaactctgctgccagagcccgggctacgactgaccatagtacggccatgg
atacatcatgcccttgtagaactgctaaaaaatgcaatggcagcaagtgttgcaaaagcg
aacagagatagcaaaaacgaagtcgatccagttcggatcaatctaggcgaggacgacgaa
atgattcttattgacatcgtagatgaagggactggaatcgaacaagagtttgaggaagtt
tttatgcttgggcactcaactgccgtcaagcgatgggatcgacttgacgagcagcaatcc
tacgcagcggttcggtcgccgttatctagtctaggggtcggtctaccgacaagtcgttgg
atgatcgagtacttccgaggctcgcttgaactttggaacaacaaggatataagtactggt
ccttctaaaggctgcacttcgcgactaaggctatatcgggatccaaatatactggaacag
gaacctcgcataaggcgatag

  All links  
No link information was found.   
DBGET integrated database retrieval system