KEGG   Phaeodactylum tricornutum: PHATRDRAFT_48489Help
Entry
PHATRDRAFT_48489  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
pti  Phaeodactylum tricornutum
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:pti03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
17
AA seq 262 aa AA seqDB search
MTDNWDDSDDEWDVDDDALDQKLGMKKVAQNLPTFDDEEDLALKEKAAREQAENAELKKK
GRALASKKQAEQERLEELEIARKAMELEAEAMANLSPDELRRMKQRQVEEADNALTDDLF
GGVDAKAGKGATGGAAAAAGDKVIMKDVKDHLKHARKVAECMQGHGKIHLAAAFFKELLQ
QSKDVLDDDAITEIIKTCNVIKNEKVQAAKRVTKVKGQAQKSKKADKAAEAKALQKQVET
FGANDEYDEYDHIGADYEDAFF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaattgggacgacagcgacgacgagtgggacgtggacgatgacgcactggac
caaaagttgggtatgaagaaagtcgctcagaatttgcccacgtttgacgacgaggaagat
ttggcccttaaggaaaaggctgctcgtgagcaagcagaaaatgcggagcttaaaaaaaag
ggacgggccttagcgagtaagaaacaagcagaacaagagcggctggaagaattggaaatc
gctcgcaaagcaatggagctggaggcggaagccatggccaatctgtcaccagatgaattg
cgtcgaatgaaacaacgtcaagtagaagaggctgataatgctttgacggatgatcttttc
ggaggagtcgatgcaaaggcgggaaaaggcgccacgggcggagccgcagcggcagcaggt
gacaaggttatcatgaaagacgtcaaggatcacttgaaacacgcccgaaaggtggcggaa
tgcatgcaagggcacggaaaaatacatctggcggcagcgttcttcaaagaattgctgcag
cagtcaaaagatgtactagacgacgacgcaatcaccgaaatcatcaagacttgcaacgtc
atcaagaacgaaaaagttcaagctgccaaacgtgtgacgaaggtcaagggccaagcacag
aagtccaaaaaagccgacaaggccgccgaagcaaaagccctgcaaaaacaggtggagacg
tttggcgcaaatgatgaatacgatgagtacgatcatataggtgccgactacgaagacgct
tttttctaa

DBGET integrated database retrieval system