KEGG   Phaeodactylum tricornutum: PHATRDRAFT_48636Help
Entry
PHATRDRAFT_48636  CDS       T01075                                 

Definition
glutathione peroxidase domain-containing protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PHATRDRAFT_48636
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PHATRDRAFT_48636
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PHATRDRAFT_48636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
18
AA seq 177 aa AA seqDB search
MSNLFKRAFGKVHDASTRLIYGVEQTTQKMSFYSCADKSMDGEAVPMSSFEGNVCLVLVD
EYGSRGLKILAFPCNQFGGQEPGSPEEILAFVAKYDKEMAKKLVFFEKADVNGANTREVY
SYLKKTCPNEDGTTDIRWNFAKFLVDHEGNAVKRSTNSPFEMKDDIEALLKKKESSA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacctctttaaacgagcattcggtaaagtacacgacgcctctacacgcttgatc
tacggagtcgaacaaacgacgcaaaagatgagtttttacagctgtgcggacaagagcatg
gacggcgaggctgtgcccatgtccagcttcgaaggcaacgtttgcctggtacttgtcgat
gagtacggaagccgcggtttaaaaatcctcgcctttccgtgtaatcagtttggcggtcag
gaaccgggatcccctgaggaaatcctcgcgttcgttgctaaatacgacaaggaaatggca
aagaagctcgtgttctttgagaaggccgacgtcaacggagccaacactcgggaagtctac
tcttatttgaaaaagacctgtccgaatgaagacggaacaaccgatattcgttggaacttt
gccaaattcttggtggatcacgaggggaatgctgtcaagcgttccacaaactcgcctttt
gaaatgaaggacgacattgaagctcttttgaaaaagaaagaaagctcggcgtag

DBGET integrated database retrieval system