KEGG   Phaeodactylum tricornutum: PHATRDRAFT_48636Help
Entry
PHATRDRAFT_48636  CDS       T01075                                 

Definition
glutathione peroxidase domain-containing protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pti00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pti00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
18
AA seq 177 aa AA seqDB search
MSNLFKRAFGKVHDASTRLIYGVEQTTQKMSFYSCADKSMDGEAVPMSSFEGNVCLVLVD
EYGSRGLKILAFPCNQFGGQEPGSPEEILAFVAKYDKEMAKKLVFFEKADVNGANTREVY
SYLKKTCPNEDGTTDIRWNFAKFLVDHEGNAVKRSTNSPFEMKDDIEALLKKKESSA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacctctttaaacgagcattcggtaaagtacacgacgcctctacacgcttgatc
tacggagtcgaacaaacgacgcaaaagatgagtttttacagctgtgcggacaagagcatg
gacggcgaggctgtgcccatgtccagcttcgaaggcaacgtttgcctggtacttgtcgat
gagtacggaagccgcggtttaaaaatcctcgcctttccgtgtaatcagtttggcggtcag
gaaccgggatcccctgaggaaatcctcgcgttcgttgctaaatacgacaaggaaatggca
aagaagctcgtgttctttgagaaggccgacgtcaacggagccaacactcgggaagtctac
tcttatttgaaaaagacctgtccgaatgaagacggaacaaccgatattcgttggaacttt
gccaaattcttggtggatcacgaggggaatgctgtcaagcgttccacaaactcgcctttt
gaaatgaaggacgacattgaagctcttttgaaaaagaaagaaagctcggcgtag

DBGET integrated database retrieval system