KEGG   Phaeodactylum tricornutum: PHATRDRAFT_48763Help
Entry
PHATRDRAFT_48763  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
pti  Phaeodactylum tricornutum
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:pti03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:pti03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
19
AA seq 436 aa AA seqDB search
MVDYDDSTQLNKWLFQSTDELELCRARANNEARTFLTNSPGEEPLLLSSETAATPTETQP
LPVKHFAYGFRQDLQTNPVVSDSYREGPLENDDGHAFLTPVEEATLVSFYASKLPSLIGP
NASVSRLRRESKVPATAALLYRRFFLSNSVLLYDPKVIMVAAAFLGSKVEDATADVRYLE
EGTALMNAPVSQAEIIPAELNLLSGTYFDLLCFHPYKTVLALTEDLRTYLKSDKGQALVS
WPPTTAADDDDVNVPAPLLSGQDLKPMYEAARALVDDCVVSDIPLLYTPGQVGLAALMVA
QAELLVRSRGNGASNQKSRIPQIDLEGYVRQRFDTDETREISMDTFLATLRTLQTQLQGL
REGQLGCYNNPSVIDMQALKAIHKKLKKVRAWGTSGSGGKSEKKKKKRGSPAGGGTANAV
DSGEPERKKMKASGAQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggtagactacgacgacagcactcagctcaacaaatggctcttccagtcaactgacgaa
ctcgagctttgccgagcgcgggcaaacaatgaagcgaggacttttctgaccaactcgcca
ggggaagaaccgctgttgttgtcgtccgagacagccgcaactccaaccgagactcaaccg
ctaccggtaaagcacttcgcgtatggttttcgccaggatttgcaaacaaatcctgttgtc
tctgactcatatcgagaagggccgttggagaatgatgacgggcacgctttcttgactcct
gtggaagaagccacgctggtgtccttctacgcgtcgaaattacccagtctgattggcccg
aacgctagcgtttctcgcctacgacgcgaatccaaagtaccagctactgccgcactcttg
taccgccgcttttttctgtccaattctgtgttactgtacgaccccaaggtcatcatggtg
gcagccgcatttctgggaagcaaagtggaagacgcaacggctgacgtccggtatctcgag
gaaggtaccgccctcatgaacgctcctgtatcacaggccgaaataattccagcggaactg
aatctgctatcagggacttactttgacttgctttgctttcatccctacaagactgttctg
gccttgacggaagatttgcggacctatctgaagtccgacaagggacaagcgctggtatca
tggccgccgaccacggccgctgacgacgacgacgtgaacgtcccagctccccttttgagc
ggacaggacttgaaacccatgtacgaggctgcccgggctttggtagacgactgtgttgta
tcggacatccctctactgtacacaccaggtcaagtgggtctagcagccctcatggttgcg
caggccgagctacttgttcgcagtcgaggcaacggcgccagtaaccagaagtcacgaata
ccccaaattgacctggaaggctacgtccggcaacgttttgatacagacgaaacacgcgaa
atttccatggacacttttttggcaacgttgcgaacacttcaaacacagttacaaggcttg
cgagaaggccaacttggatgttacaacaatcccagcgtcattgatatgcaagctctcaag
gctatacacaaaaaactgaaaaaggttcgagcctggggaacgtcgggcagtggggggaaa
agtgaaaaaaagaaaaagaagcgcggctcgcctgcaggcggcggtacggccaacgcggtc
gatagtggcgaaccggagcggaagaaaatgaaagcgtccggagcccagtga

DBGET integrated database retrieval system