KEGG   Phaeodactylum tricornutum: PHATRDRAFT_48763Help
Entry
PHATRDRAFT_48763  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
pti  Phaeodactylum tricornutum
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pti00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PHATRDRAFT_48763
  Replication and repair
   03420 Nucleotide excision repair
    PHATRDRAFT_48763
Transcription machinery [BR:pti03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PHATRDRAFT_48763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
19
AA seq 436 aa AA seqDB search
MVDYDDSTQLNKWLFQSTDELELCRARANNEARTFLTNSPGEEPLLLSSETAATPTETQP
LPVKHFAYGFRQDLQTNPVVSDSYREGPLENDDGHAFLTPVEEATLVSFYASKLPSLIGP
NASVSRLRRESKVPATAALLYRRFFLSNSVLLYDPKVIMVAAAFLGSKVEDATADVRYLE
EGTALMNAPVSQAEIIPAELNLLSGTYFDLLCFHPYKTVLALTEDLRTYLKSDKGQALVS
WPPTTAADDDDVNVPAPLLSGQDLKPMYEAARALVDDCVVSDIPLLYTPGQVGLAALMVA
QAELLVRSRGNGASNQKSRIPQIDLEGYVRQRFDTDETREISMDTFLATLRTLQTQLQGL
REGQLGCYNNPSVIDMQALKAIHKKLKKVRAWGTSGSGGKSEKKKKKRGSPAGGGTANAV
DSGEPERKKMKASGAQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggtagactacgacgacagcactcagctcaacaaatggctcttccagtcaactgacgaa
ctcgagctttgccgagcgcgggcaaacaatgaagcgaggacttttctgaccaactcgcca
ggggaagaaccgctgttgttgtcgtccgagacagccgcaactccaaccgagactcaaccg
ctaccggtaaagcacttcgcgtatggttttcgccaggatttgcaaacaaatcctgttgtc
tctgactcatatcgagaagggccgttggagaatgatgacgggcacgctttcttgactcct
gtggaagaagccacgctggtgtccttctacgcgtcgaaattacccagtctgattggcccg
aacgctagcgtttctcgcctacgacgcgaatccaaagtaccagctactgccgcactcttg
taccgccgcttttttctgtccaattctgtgttactgtacgaccccaaggtcatcatggtg
gcagccgcatttctgggaagcaaagtggaagacgcaacggctgacgtccggtatctcgag
gaaggtaccgccctcatgaacgctcctgtatcacaggccgaaataattccagcggaactg
aatctgctatcagggacttactttgacttgctttgctttcatccctacaagactgttctg
gccttgacggaagatttgcggacctatctgaagtccgacaagggacaagcgctggtatca
tggccgccgaccacggccgctgacgacgacgacgtgaacgtcccagctccccttttgagc
ggacaggacttgaaacccatgtacgaggctgcccgggctttggtagacgactgtgttgta
tcggacatccctctactgtacacaccaggtcaagtgggtctagcagccctcatggttgcg
caggccgagctacttgttcgcagtcgaggcaacggcgccagtaaccagaagtcacgaata
ccccaaattgacctggaaggctacgtccggcaacgttttgatacagacgaaacacgcgaa
atttccatggacacttttttggcaacgttgcgaacacttcaaacacagttacaaggcttg
cgagaaggccaacttggatgttacaacaatcccagcgtcattgatatgcaagctctcaag
gctatacacaaaaaactgaaaaaggttcgagcctggggaacgtcgggcagtggggggaaa
agtgaaaaaaagaaaaagaagcgcggctcgcctgcaggcggcggtacggccaacgcggtc
gatagtggcgaaccggagcggaagaaaatgaaagcgtccggagcccagtga

DBGET integrated database retrieval system