KEGG   Phaeodactylum tricornutum: PHATRDRAFT_48774Help
Entry
PHATRDRAFT_48774  CDS       T01075                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHATRDRAFT_48774
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHATRDRAFT_48774
   00052 Galactose metabolism
    PHATRDRAFT_48774
   00500 Starch and sucrose metabolism
    PHATRDRAFT_48774
   00520 Amino sugar and nucleotide sugar metabolism
    PHATRDRAFT_48774
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    PHATRDRAFT_48774
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PHATRDRAFT_48774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
19
AA seq 429 aa AA seqDB search
MTNLRKSIYLLTADVGGTNSRMSLYDAEATCCEDKPLVVKYYRNSEHLTCHVDDPKAFPK
HIVIPFLKYCWNEAEKKDDLVPLKSCQIIACFATAGIVSNNKVNMTNLDDLLIDGNAIQN
DQKDPYLKHVIVCKIINDFVAQGYGCLTLSESDVVHLGGPQSFPLESLKNGPKVCVGAGT
GLGECYLTQGSVSDEYTCFPSEGGHVEYAPRHNLEVRLFEFLNEKFCTKDRISVERVVSG
KGLANVYEFLAHEFPERILPEVHDQFLNSGDEQGKIVSDNATEGSLCLQAMSIMMSAYGC
EVGSAAIKFIPTGGLFVTGGLTPKNIKYIHGHNTEFMLAYRNKGRVSTLLDRIPLFAVMV
EDLGVRGAHKAARMEYERFLRDNDQTNGAVKRKSTSLGKLVQEYAWTSMALSAIAALTVN
ALLNRKSWK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaccttcgtaagtccatctacttgctgacggcagatgtcggtgggaccaacagt
cgtatgagcttgtacgacgccgaggcgacgtgttgcgaagacaagccccttgtcgtcaag
tattaccgaaattccgaacatcttacgtgccacgtcgacgaccccaaggcctttcccaag
catattgtgattccctttctcaagtactgctggaacgaagctgagaaaaaggacgatctt
gttccattgaaatcttgtcaaattatcgcgtgtttcgccacggccggaattgtgtccaac
aacaaagtcaacatgacaaatctagacgacttgctcatcgacggcaacgccattcaaaat
gaccagaaggatccctatttgaagcatgtcatcgtttgcaaaattatcaacgacttcgta
gcccaagggtacggctgcttgacactcagcgaatccgacgtcgttcatctcggcggccct
cagtcctttcctttggaatcgctcaagaatggacccaaggtctgtgtgggtgccggtacc
gggctcggagagtgctatttaacgcaaggttccgtatcagacgaatacacctgctttccc
agtgaaggtggtcacgtagagtacgccccacggcacaaccttgaggtaaggttatttgaa
tttttgaacgaaaagttctgcacgaaggatcggatctctgtcgagcgagttgtttccggg
aagggcctcgccaacgtgtacgagtttctcgcacacgaatttccagagcgcatccttccc
gaagttcacgaccagtttctgaactcgggagatgaacaaggcaagatcgtatcggacaac
gcgacggagggatcattgtgtttgcaggcgatgagtataatgatgagtgcgtacggatgt
gaagtgggatcggctgctatcaaattcattccaacgggtggtttgtttgtgacgggaggt
ttgactcccaagaacatcaaatatattcatggacacaatacggaatttatgctggcgtac
cgtaacaagggtcgagtttcgacacttttggatcgtatccctctgtttgctgttatggtg
gaggacttgggtgtacgcggtgcacacaaggctgccaggatggagtatgagcgattcctt
cgggacaatgaccagactaatggtgcagtcaaacgaaaatcaacatcgttgggaaaattg
gtccaggaatatgcttggacttccatggcactgtcggcgatcgcagcgctgacagtgaat
gcacttttgaatcgtaaatcttggaagtag

DBGET integrated database retrieval system