KEGG   Phaeodactylum tricornutum: PHATRDRAFT_48970Help
Entry
PHATRDRAFT_48970  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PHATRDRAFT_48970
Enzymes [BR:pti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PHATRDRAFT_48970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
20
AA seq 440 aa AA seqDB search
MAGPSKRPCSRVWQSLVLRLLGAASLWLIDVTLAADFDFPNATVTTLAFGSCHKRKYAAP
HVWRSVQAQQPQAWLWTGDSVYPPAHGMASVELLEEEYRQMKTNASLGYATFQPPLGIFG
TWDDHDYGGNDMGSSMPDQAARSRAFWDFLGRQPPSRHGLYHSVSWGNPPSRQVQVFFLD
TRSFRRDHCVPSVATYIPLGAGIACLTRWLSAGLWPSLCQAPDNALLGHAQWDWLATELS
QSQASVNVIVSSIQVLTTNPVMETWGHFPLERAKLLQLISDSRARGVALLSGDVHHGEIL
DPWANWKKSGADTFSSLLEVTSSGMTHTCTKGLYGALCRPLLDAFASHRQRPDAYYTGRN
FGILTIDWSQATFTVNVLDQDGRGVLSTGPQKFNQRALTPKEVLAVPDCVDGHLQTSVFV
AIVAGLLWVWARIRNEQNKK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtccatcgaaacggccttgttcccgggtgtggcaaagtctggttctccgtcta
ctgggtgctgctagcctttggctaattgacgtaaccttggcggcggactttgactttccg
aacgctaccgtgacaacgttggcctttggttcctgccacaaacgcaaatatgcggcacct
cacgtatggcgatccgtccaagcccaacagccgcaagcgtggttgtggacgggtgattcc
gtctatcctcccgcacacggcatggcgtccgtggagctactggaggaagaatatcgtcaa
atgaaaacgaatgcgagtctcggatacgccacctttcaaccaccgctcggaatatttggc
acttgggacgatcacgactacggaggcaacgatatgggatcgtccatgccggaccaagcc
gcgcggtcgcgtgccttttgggactttctgggtcggcaacctccatctcggcacggattg
taccacagcgtctcttggggcaaccctccgtcacggcaagtgcaggtattctttctggat
acgcgttcgtttcgacgagaccattgcgtacccagtgtcgccacctatatcccactgggt
gcgggaattgcgtgtctcacgcgatggttgtccgctgggttgtggcctagtctgtgtcag
gctccggacaatgccttgctcggacacgcacagtgggactggctggccacggagctgtct
cagtcacaagcatcagtgaacgtcattgtcagtagtatccaagtgctgactaccaatccg
gttatggaaacctggggacattttcccttggaacgggcgaagctcttgcagttaattagc
gatagccgcgccaggggtgtggccttgctctccggtgacgtacaccacggtgaaatcttg
gatccgtgggcgaattggaaaaagagcggcgcggacactttctcttccctattggaagtg
accagctcgggtatgacccatacctgcaccaaaggtttgtacggagctctttgtcgccct
ctcttggacgcgttcgcctcccatcggcaacggcccgatgcctactatacgggccgcaat
tttggtattttaacgatcgactggtcgcaagcaaccttcacagtgaacgtcctggaccaa
gacggcagaggcgtcctgtccaccggaccacaaaagtttaatcaacgtgcgctaacgccg
aaggaagtgctggccgttcccgattgtgtggatggacatttgcaaacatcggtcttcgtg
gctatcgttgctggcctcctttgggtgtgggcaagaatacggaatgagcagaacaaaaag
tga

DBGET integrated database retrieval system