KEGG   Phaeodactylum tricornutum: PHATRDRAFT_49056Help
Entry
PHATRDRAFT_49056  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHATRDRAFT_49056
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHATRDRAFT_49056
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PHATRDRAFT_49056
Enzymes [BR:pti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PHATRDRAFT_49056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
20
AA seq 504 aa AA seqDB search
MPSVTYSSTRGGQTNLAFRDVVMQGLAHDRGLFVPDRLPTVSTTELESWRSLSYAELAVN
VIAKFVGDDQVPLPNLRDIVTRSCAAFRDAQVTPLVHVGGHYVLELFHGPTFAFKDVALQ
MLGNFFEYFLSTGSNGGRLAVLGATSGDTGSAAIAGLRGKKGITCVILFPNGRVSAIQER
QMTTVPDENVHCVAIDGTFDDCQDIVKASFNTPAFRDKVHLGAVNSINWCRVLAQTTYYY
WSYLRVTDAHKDIPEVHFSVPTGNFGDVLAGYYAKQMGLPVGKLIVATNENDILHRFFTA
GEYHRESIAETISPSMDICVSSNFERYLFHLAGNDASMLSAWMQAFEKTGQLTIQGDLLR
QAQADFDSCRGDTSQTLATIETYHQKHQYVLCPHSAVGVYAIHQLSLVSSATVCLATAHE
AKFPAAVAQVVEPMPPPPTELAVLRDLPTRRVELPNDLATVQAFVEECVFSRPRKWQAVA
KHLAAVTVAVGVAAVALQAMTRRR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgccttcggtgacgtacagtagtacccgcggcggtcaaacgaacctcgcctttcgggat
gtggtaatgcagggtttggcgcacgatcggggcttgttcgtcccggaccgtctaccgacg
gtgagcacgacggaactggaatcctggcgatctctgtcgtacgccgaattagcggtcaac
gtcattgccaagttcgtcggcgacgatcaggtgcccttgcccaatttacgggatattgtc
acccggtcgtgtgcagcctttcgcgacgcacaagtcacgcccctcgttcacgtcggggga
cattacgtgttggagctatttcacggacccacctttgctttcaaagacgtggctttgcaa
atgctcggcaactttttcgaatactttttgagtacgggcagtaacgggggtcgcctcgcc
gtgttgggcgccacgtccggggataccggttcggccgccattgccggattgcgcggcaaa
aagggcatcacttgcgtcattttgttccccaacggacgcgtctcggccatacaggaacga
caaatgaccaccgtgccggacgagaacgtgcactgtgtcgctatcgacggcacctttgat
gattgtcaagatatcgtcaaggcgagtttcaacacaccggcctttcgggacaaggtgcac
ctgggagcggtcaattccattaattggtgtcgtgttttggcgcagacgacctattactac
tggagttacttgcgtgtgacggacgcccacaaggacatcccggaagtccatttttccgtc
ccgacgggaaactttggggacgttctggccggttactacgccaagcaaatgggtctgccc
gtaggcaaattgatcgtcgccaccaacgaaaacgacattctgcatcgcttctttaccgcc
ggcgagtaccaccgcgaatcgattgcggagacgatctcacccagcatggatatttgcgtc
agcagcaactttgaacgctacctgttccacttggccggcaacgacgcgagcatgctgagc
gcgtggatgcaagcctttgaaaagacgggccaactgaccattcaaggtgacctgttgcgg
caggcccaggccgactttgattcttgtcgtggcgatacgtcgcagactctcgccacgatt
gaaacttaccaccagaagcatcagtacgtcttgtgtccgcattccgcggtgggtgtgtac
gctatccaccagttgtccctggtttcgtcggccacggtctgtttggccacggcccacgaa
gccaaattccccgccgccgtggctcaggtcgtggaaccaatgccacccccaccgaccgaa
ctcgctgttctccgggacttgcccacccgtcgcgtcgaattaccgaacgacctggccacg
gtacaagcctttgtggaagagtgcgtcttttctcggccacgcaaatggcaagcggtggcg
aaacatttggccgcggtgaccgtggcggtgggtgttgccgccgtggcgttgcaagccatg
acccggcgacgataa

DBGET integrated database retrieval system