KEGG   Phaeodactylum tricornutum: PHATRDRAFT_49563Help
Entry
PHATRDRAFT_49563  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00511  Other glycan degradation
pti00520  Amino sugar and nucleotide sugar metabolism
pti00531  Glycosaminoglycan degradation
pti00604  Glycosphingolipid biosynthesis - ganglio series
pti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PHATRDRAFT_49563
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    PHATRDRAFT_49563
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    PHATRDRAFT_49563
   00604 Glycosphingolipid biosynthesis - ganglio series
    PHATRDRAFT_49563
   00511 Other glycan degradation
    PHATRDRAFT_49563
Enzymes [BR:pti01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PHATRDRAFT_49563
Chaperones and folding catalysts [BR:pti03110]
 Intramolecular chaperones
  Others
   PHATRDRAFT_49563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2
Motif
Other DBs
NCBI-GeneID: 7198229
NCBI-ProteinID: XP_002184293
JGI: 49563
UniProt: B7GB18
Position
23
AA seq 973 aa AA seqDB search
MESARSRNTRDGTRKQGTARRSGGTTSSNGNQGFDEFGFGQPAFPDSAFDNHGFEMPQTR
IQPTKIRSRRRASLAAAPNIDVVSENPSIGFTNQFQSSQDEQVSRGGARLAKAGRSSRSM
DGIEFPTARKDVSSQNRPRRSGRRASMATSSNHSLSASNHTNPELGYGDAIPSVAANHRK
GDSNSGILDFGFGGGKNAGTANADYGYGDTMSSGFGNFESMPSAPSTTPESERPRRSGRR
SSISGGLESLRSDLRGGDLSGAPSSRVLGGNSRAQNIVLPMAGPEKVAGGNVRRGRRGSL
LGSVGNAVGATMGGFTGGNKDKEKLDDDTTKKSKSFLKDRKAEGRRGTTRQPSADGNIIS
SYTGDRDRRRKPAASSKTLGKESNVSYSDRILAQRDCSCGGEGSSSSGSGSSDGSSACCR
SKIWPAARCETYRTLEIDASSSMTLRRHGLRGLHISPTQSVGDESSFDVDCHGYCQDVQS
ILDAAYVRFLKALRRSVSSTPLAHHDRRENEKVAQHDNVQALLGIHISITTNESALVHDA
DERYQLDVPGPTVTENDDDDDGSYIHLTAPTVYGILHAYQSLLQLVTFVGRDSQTGAFVF
AMPDTTLIRIRDGPVYPYRGLMIDTARHFLPLPLILQNLDAMEASKLNVLHWHVTDSQSW
PYVSTAFPELSARGAFGPEETYTATDIALVVREAAARAIGRSHPEWLTPCGSKPRPQEPL
DATNPAVYEFVHRLYDELAILFAHESFLHVGGDEVNLDCYHNSTTVQRWMRKHNMTQELE
VLSYFERDLLSYVTAVLNRRPIVWQELFDSGLGLPNQTIVDVWKSWEPSSRYNATLRGHE
VILSSCWYLDHLNEDWQSFYACDPREFNGTKEQKNLILGGHASMWGERVDATNFLSRVWP
RASATAEKLWTGNLTAAADSAASRLAAFRCHLVRRGIPASPVGPGASCGRQPNGFPAVID
SFHDEELQEGKVT
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atggaatctgctcgctctcgaaatacccgggatggcacccgaaagcaaggtacggcacga
agaagtggcggtactactagtagcaatggcaatcaaggcttcgacgagtttggatttggt
caacctgcctttccggattctgcgtttgacaaccacggctttgagatgccgcaaactcga
attcagccaacgaagattcgttcccgccgtcgagcatctttagctgcggcgccgaacatt
gacgttgtgtcggaaaacccgtcaataggttttaccaatcaatttcaatcttcacaagac
gaacaggtgtctcgtggtggagcccgcttggcaaaggcgggacgctcatcgcgctcaatg
gacggcatcgaattcccaactgcacgcaaggacgtttctagtcaaaatcgtcctcgtcgt
tcgggtcgccgggcttcaatggctacttcttccaaccacagcctttccgcttccaatcac
accaacccggaactcggttacggagacgccattccgtctgttgctgctaaccatagaaaa
ggagactctaatagcggaattttggacttcggctttggtggtggtaagaatgccggtaca
gccaatgccgactacggctacggtgacacaatgtcgtcgggttttggtaatttcgagtct
atgccatccgcgccttccaccacacccgaatctgaacgtccgcgtcgcagcggacgacgc
tccagtatcagtggaggtcttgaaagtctacggtctgacttgcgcggaggcgacctgagt
ggtgctccgtctagtcgggtgttgggtggaaattctcgcgcccagaacattgtgttgccc
atggccgggccggaaaaagtggccggtggcaatgttcgtcgtggacgtcgcggatcctta
ctgggtagtgttggtaatgcagtcggagctaccatggggggattcactggtggaaataag
gacaaggaaaaactcgacgacgataccaccaaaaagtctaagtcttttctaaaggatcgc
aaggctgaaggtcggcgaggcacgacacgtcaaccatcggccgatggcaatataatctct
tcctataccggcgatcgcgaccgacgccgcaagccggcagcgtcgtccaagaccctgggc
aaagagagcaacgtgtcgtactcggatcgtattttagcacagcgtgactgtagttgtgga
ggtgaagggagcagcagtagcggtagcggtagcagtgacggtagtagtgcttgttgtcgc
agcaaaatttggccggcggctcgatgtgaaacctaccgaacactcgaaatcgatgcttcc
tcctctatgacattgcgacggcacggcttgcgaggactgcatatctcccctactcaaagc
gtaggggacgaaagtagcttcgatgtggactgccatggatattgtcaagacgttcaatcg
atactggacgccgcgtacgttcgctttctcaaggcgctccggcgaagcgtgtcttccacg
cctttggcgcatcacgaccgtcgcgaaaatgaaaaggtcgctcaacatgacaacgtacag
gctctgttgggcattcacatttccattactacgaatgagtctgcactcgtacacgacgcg
gacgaacgataccaactggacgtcccagggcctaccgtcactgaaaacgacgacgacgac
gatggcagctacattcatctcactgcacccaccgtctacggcattctgcacgcctaccaa
agcttactgcagctggtgacgtttgttggtagggactctcaaacaggcgctttcgtattc
gccatgccggacacaaccctcattcgaatccgtgatggacccgtgtatccctaccgggga
ctcatgatcgacacggcccgacattttttgccactaccgcttatcttgcaaaacttggac
gccatggaggccagtaaactgaacgtcttgcactggcacgtgactgattcgcagtcgtgg
ccctacgtcagtactgcttttccggagcttagtgctcggggagcctttggtcctgaagaa
acctacacggctacagatattgccctcgtcgtgcgggaagccgccgcacgggcgattgga
cgctcacatccggaatggttaacaccctgtgggtccaagccacggccgcaagaacctttg
gatgcgaccaatccggccgtctacgaattcgtacaccgcctctacgacgaattggcaata
ctctttgcgcacgaatcctttttacacgtcggaggagacgaagtcaatttagattgttac
cacaatagcacgacggtccaaagatggatgcgaaaacacaatatgacacaggaacttgag
gttctgagctattttgagcgtgatttgctttcgtacgtcaccgctgtattaaatcgtcgt
cccattgtgtggcaggaactcttcgattcgggattgggtcttcccaatcagacaattgtc
gatgtctggaaatcgtgggaaccttcgtcgcgatacaacgccactttgcggggccacgaa
gttattttgtcctcgtgctggtatctcgatcatttgaacgaagattggcaaagcttctac
gcctgtgatccacgggagttcaacggtacgaaagaacagaagaacttgattctgggcggt
cacgcttccatgtggggggaacgggtggatgcgaccaactttctatctcgtgtttggccc
cgtgccagtgctacggccgaaaagctgtggacaggcaacttaacagctgcggcggattcg
gcggcttctcgattggccgcctttcgctgtcatttggtccgcagaggaattccggccagt
ccggtcggtccgggagcaagttgcggcagacaaccaaatggttttccggctgtgatcgat
agctttcatgacgaggagttgcaggaaggaaaggttacttga

DBGET integrated database retrieval system