KEGG   Phaeodactylum tricornutum: PHATRDRAFT_50723Help
Entry
PHATRDRAFT_50723  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pti  Phaeodactylum tricornutum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PHATRDRAFT_50723
Enzymes [BR:pti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PHATRDRAFT_50723
Exosome [BR:pti04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PHATRDRAFT_50723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 403 aa AA seqDB search
MRFSSIYIASMAVSVSAFMTPSPTSSTRANTALFGAPCFDPVDKTLKGVDADSTGFDPMA
GSNPAVIRNNNDEVWVPQRARPRRNRKSAAMRGMVRECIVTPSNFIYPLFIHDEENNQAI
ASMPGCERHSLDSMLKEVGESFELGVKTFVLFPKVDDALKTNLGVEAYNPDGIVHRAIRM
IKEKYPESIVCTDVALDPYSDQGHDGVVENGKILNDVTITQLCKQAVSQARAGADIVAPS
DMMDGRVKAIRDALDSEGFTDVSILSYTAKYASAYYGPFRDALDSHPGFGDKKTYQQDPA
NGREALVEAALDAAEGADMLMVKPGMPYLDVIRRLKDNSDLPIAAYHVSGEYAMIKAACE
RGWLNEKDVVLETLTCFKRAGADIILTYYAKQAAKWIQEDGLY
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaggttctcttcaatttacatcgcctcaatggcggtcagtgtctctgctttcatgact
ccgtcgcctacttcgagcacgagggcaaacacggcattgtttggggccccgtgttttgac
ccagtcgataaaacactgaaaggtgtggatgccgatagcactggtttcgatccaatggct
ggatccaaccctgcagtaattcgcaacaacaacgacgaagtttgggttcctcagcgtgct
cgcccccgtcggaaccgtaaatctgctgctatgcgtggcatggttcgggaatgcattgtc
acccccagcaacttcatttatcccttgttcattcacgatgaagaaaacaaccaggcaatt
gcatccatgccggggtgcgagcgccactccttggattccatgctgaaagaagtcggagaa
tcgtttgagcttggcgtcaagacattcgtgctttttccgaaggtggatgacgccttaaaa
acgaatttaggcgtggaagcatacaaccccgatggcatcgtacatagagcaattcgaatg
atcaaagaaaaataccctgaaagtattgtatgtaccgatgtcgcgttggatccatactct
gatcaaggccacgacggtgtcgttgaaaacggaaaaatcctgaacgatgttaccattaca
cagctatgtaagcaggccgtgagtcaagccagagcaggcgccgatattgttgccccaagt
gacatgatggatgggcgcgtcaaggcaattcgtgatgcgcttgattcggaaggtttcacc
gatgtttctattctttcatacacggcgaaatacgcttcagcctactatggacctttccgt
gatgcgttggacagtcacccgggtttcggcgacaaaaagacgtaccagcaagaccctgcc
aatggtcgggaggccttggttgaagccgccctggatgcggccgaaggcgccgatatgctc
atggtcaaaccaggaatgccgtatcttgatgtcattcgccgacttaaggataattccgat
ttgccgatagctgcttaccacgtttcgggggagtatgccatgataaaggcggcttgcgag
agagggtggttgaatgagaaagatgttgtactggaaacgctgacatgcttcaagcgtgca
ggcgctgacattattttgacgtattatgctaagcaagccgcaaaatggatccaagaggat
ggactttactaa

DBGET integrated database retrieval system