KEGG   Phaeodactylum tricornutum: PHATRDRAFT_50740Help
Entry
PHATRDRAFT_50740  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pti00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 800 aa AA seqDB search
MVSSSKSTWMMAGACLILMAFQVQSFTFVPATRATSTVKRVAPAFMSAVADDKSETSETE
AAARARLVMEAEAAMNGGSSKIGIKDTKLMDLGGRPFPLSMIVGQDSIKQALLLSAINNR
MGGVVISGGKGTSKSVMARALHQLLPPIEILKDSAFNIDPEGEFGLDDFTRTEIDNGGTP
LADRETEIIPCPFVQVPLNVMEDRLIGSADLEESVKSGKTVFAPGLLAKAHRGVLYVDDI
NLLDEETANILLNVVSDGYVLVEREGISLRYPCRPLLIATFNPDEGELRDHLLDRIAIAL
STNADRLDIGQRVDAVESVLDFASSGKQKTDKAEVALQEAIDNEDDLKTAIVFAHEYIKD
LKVAPSQMQYLCEEAIRAGCQGHRAEIFACEVARASAALEGRQVTSEDLRLAVKLAIAPR
GTFINTPMDPDEMMPPPPPPPPPPPQMDDQSQDQDEDQEDDDEQPDEKEDEEEDEDREDE
APDVPEVPQEFMFDIDATPMDPDLIDFTSRERSGKGGGRGLIFSQDRGRYIKPMLPKGKV
IRLAVDATLRASAPYQKSRRERAVGTSKEGRGVHIQQSDVRIKKMARKAGSLIIFVVDAS
GSMALNRMNAAKGAAVSLLTEAYQSRDKISLIPFQGEMADVLLPPTKSITMARQRLEQMP
CGGGSPLAHALQLATLTGINAQKSGDVGKVVVVLISDGRANVPLCVSMGEEFDPESDEDS
KDGKPSRSYLKDEVLACAKRLGSQGGFNLLCIDTENKFISTGLAKEIADAALGKYHQITK
ADGKAIASVTSQALNQIKSK
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggtttcatcctccaaatcaacatggatgatggcgggggcttgccttattttgatggca
tttcaggtccaatcatttacgttcgttccggcaacacgagcaacatcgacagtcaaacgg
gttgccccggcctttatgagtgccgtcgctgacgacaaatcggaaacatccgagacggaa
gcggcggcacgcgctcgtctcgtcatggaagccgaggccgccatgaatggtggcagtagt
aagattggcatcaaagacaccaaacttatggatctgggtggtaggccgtttccgttgtcc
atgattgttggtcaggattccatcaaacaggccttgttgctatcggcaattaataatcgt
atgggtggggtagtaatttcgggaggcaaggggacttcgaagtctgtcatggccagagct
ctgcatcaactgctacctccgattgaaatccttaaggattctgccttcaatattgacccc
gaaggtgaatttggactcgatgatttcactcgtactgaaatcgacaatggcggcactccg
ttggcggaccgcgagacggaaatcattccgtgtcccttcgtgcaagttccgcttaacgtg
atggaagatcgtttgataggaagtgccgatttggaagaaagtgtcaaatcgggcaagacg
gtttttgctcctggcttgttggcaaaggcacatcgaggagttctctacgtcgacgatatc
aatctcctcgacgaagaaacagccaatatcctgttgaacgttgtctccgacggatatgtc
cttgttgagcgtgagggtatatcactgcgatacccttgccgtccgttattgattgctacc
ttcaacccggacgagggagaactccgtgaccacttgcttgatcgcatcgcaattgcgctt
tcgaccaacgctgatcgcttggatattggacagcgcgtagacgccgtcgaaagtgtacta
gatttcgctagttccggaaaacaaaagaccgacaaggcagaagttgctctgcaggaggct
atcgacaacgaggacgatctcaaaacagccatcgtttttgctcacgaatacatcaaggac
ctgaaggttgcgccttcgcagatgcagtacttgtgtgaagaggccatccgcgccgggtgc
cagggacatcgtgctgaaatttttgcctgtgaagtggctcgtgcgagtgccgcactggaa
ggtcgccaggtaactagtgaggatctgcgtctggctgtcaagcttgcgattgctccccgt
ggaacctttataaatacaccgatggatccggacgagatgatgcccccgccaccgccacct
ccgccgccgccaccgcaaatggacgaccaaagtcaggatcaggatgaagaccaggaagat
gacgatgaacaaccggatgaaaaagaagacgaggaggaagacgaagatcgcgaagatgaa
gcccctgatgtaccggaagtaccacaagagttcatgttcgacattgatgcgaccccaatg
gacccagatctcattgactttactagtcgggaacgtagcggcaagggaggaggccgtggt
ctcattttttcgcaggaccgtggccgttacatcaagcccatgttaccgaagggcaaggta
attcgtctggctgttgacgcaactctccgtgcgtctgctccttaccaaaagtcacgtcgt
gagcgcgcggttggtacctcaaaggaggggcgtggggtccacattcaacagtcggacgtg
cgcatcaagaagatggcacgtaaggcaggttcattgattatctttgtcgtggacgcttcc
ggatcgatggctctcaaccgcatgaatgccgctaagggcgcggccgtcagtctcctgacg
gaggcataccaaagccgtgacaaaatctcactcattcccttccagggagaaatggccgat
gttctgctacctcccacgaaatccatcaccatggctcggcaacggctcgaacaaatgcct
tgtggaggaggctctccactagctcacgcactgcaattggcaacgctcaccggtattaac
gcccagaagagtggggacgtcggtaaggttgtggtcgtattgatttccgacggtcgagcg
aacgttcccctttgtgtgtccatgggcgaagaattcgacccagaatcagacgaggattcc
aaggatggcaagcccagtcgaagttatttgaaggacgaagtattggcgtgtgccaagcga
ctgggatcccaaggaggcttcaacttgctttgtattgatacggaaaacaagttcatttcg
accggtttggccaaggaaattgccgatgccgctttgggcaagtatcaccagattaccaaa
gccgatgggaaagcgatcgccagcgtgacaagccaagcgctgaaccagattaaatccaag
taa

DBGET integrated database retrieval system