KEGG   Phaeodactylum tricornutum: PHATRDRAFT_50848Help
Entry
PHATRDRAFT_50848  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PHATRDRAFT_50848
Transfer RNA biogenesis [BR:pti03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    PHATRDRAFT_50848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 544 aa AA seqDB search
MTSQSSHKSNYALAISFLVQELMDAYDNGDTVNLTQLKGKASRKFKLKGIPKMSDILQGL
PINYRSKLWPYLQTKPVRTASGVAVVAVMSKPHRCPHIAYTGNVCVYCPGGPDSDFEYST
QAYTGYEPTSMRAIRARYDPYSQVKGRVAQLRAIGHTVDKVEFIVMGGTFLSLDKEYKDY
FIRNLHDALSGYHSQTVEESVRYSEQAVTKCIGITIETRPDYCLKPHLEEMLSYGCTRIE
IGVQSIYESVARETNRGHTVAAVSHSFQLAKDCGFKVVTHMMPDLPNMGYERDLEGFKEY
FENPMFRSDGMKLYPTLVIRGTGLYELWKTGRYQNYTPDQLVELTAQVLSLIPPWTRLYR
VQRDIPMPLVSSGVEHGNLRELALQKMREQDLPCLDIRSREVGMKQIHHSVTPDQVELVR
RDYVANGGWETFLSYEDPTQDILIGLLRLRKTSPAAWLKEVAEYPSSIVRELHVYGTAVA
VSARDPTRFQHQGFGILLMEEAEHIARDEHGSKKLLVIAGVGTRHYYRKMGYHLDGPYMS
KMLL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgcaatcgtcccacaaatcgaattacgcgctggccatttcctttctggttcaa
gagctgatggatgcgtacgacaacggtgataccgtcaatttgacgcaactcaaaggcaag
gcctcgcgcaagttcaagttgaagggaattcccaaaatgagtgacatactgcagggtcta
ccgatcaattaccgcagcaagctatggccgtacctgcagaccaagccggtccgtacggcc
tctggcgttgcggtcgtcgccgttatgagcaagccacaccggtgtccgcatattgcctac
actggaaacgtttgcgtttactgccccggtggaccggatagtgactttgaatatagcacg
caggcgtacactggatacgaaccaacctccatgcgcgccattcgagcccgttacgacccc
tacagtcaagtcaaaggacgtgtcgcgcaactgcgagccattggacatacggtagacaag
gtagaattcattgttatgggagggacctttctgagtttggataaggagtacaaagattat
ttcattcgtaacctacacgatgctttgtcgggatatcattcgcaaacagtggaagaatca
gttcgatactcagagcaagctgttaccaagtgcattggaattactattgaaaccaggcct
gattactgcttaaagccacacttggaagagatgctttcgtacggctgtacgcgaatcgaa
atcggtgtacaaagtatctacgaatccgtggcacgagaaactaatcgcggacatacggtg
gcggctgtttctcactcgtttcagctagcaaaggattgcggcttcaaagttgtcacgcac
atgatgccggatctaccaaatatgggctacgaacgagacttggagggcttcaaggagtac
tttgaaaatccaatgttccgaagcgacggtatgaagctatacccgactctagtcatccga
ggaacgggcttgtacgaattgtggaaaacaggtcgataccagaattatactccagatcaa
ttggtggaactaaccgcgcaagttttgagcctcattccaccgtggacacgtttgtatcga
gtccagcgtgatattccgatgccactcgtctcatctggtgttgagcacggcaacctccgt
gaactcgccttgcaaaaaatgcgggagcaagatttgccgtgtctggatattcgatcgcga
gaagttgggatgaagcagattcatcactccgtcacgcctgatcaggtcgaactagtgcgg
cgcgactacgttgccaatggcggatgggaaacttttcttagctacgaagatccgacacag
gacattctgatcgggctgctgcgattgcgcaaaacatcgcctgctgcatggttgaaggaa
gttgccgaatatccttcaagtattgtacgagaattgcacgtatacggcactgctgttgcc
gtctcggctcgcgacccgactcgttttcagcatcaaggctttggtattctgctaatggaa
gaagccgagcatattgcccgggacgagcacgggtccaaaaagttactcgtcattgcgggg
gtcggaacgcggcactattaccgcaagatggggtaccacctggacggaccgtatatgagc
aaaatgttgctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system