KEGG   Phaeodactylum tricornutum: PHATRDRAFT_50961Help
Entry
PHATRDRAFT_50961  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     PHATRDRAFT_50961
Protein kinases [BR:pti01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   PHATRDRAFT_50961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 7201619
NCBI-ProteinID: XP_002180748
JGI: 50961
UniProt: B7G0X2
Position
10
AA seq 357 aa AA seqDB search
MEFGNVKPWKALSVSTELVLIQVAGFLRRELPIRLAHRIRDLEGIPLLKDMASIQLVRDL
YVKSFLELLSFDKLIQSAEQEEGFAALIENIYDRHSKVLVQMAQGAYEFRSAVRQEKGAD
GFELQEETHRFLDRFYLDRIGIRVLIGQYLALRQPPVENYVGIICSHTSPYEIVKRAIDD
AAFMCTRKYGDAPEVIMSGRLDLTFPYVPTHLHYIMLELIKNSMRATVEWHGIDSPEFPP
IKVIIADGADNEDVVIKVSDEGGGIPRSNMGKIWSYLFTTADPAIQAGMVGTAGAKGQGQ
DHGIDSPLAGLGYGLPISRSYCRYFGGDLSIMSMEGFGTDAFVYLTRLGNTSEPVPI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaattcggaaatgtgaaaccatggaaagctctgtccgtctcgacggaacttgtgttg
atccaagtagccggattcttacgtcgcgagctgcccatccgactcgctcatcgtatccgc
gatctggaaggcataccactactcaaggacatggccagtatccagttggtaagggacttg
tacgtgaagagttttcttgaattgctcagcttcgacaaattgatacaatcagccgaacag
gaagaagggttcgctgccttgattgaaaatatctacgatcggcattccaaagttctggtt
caaatggcccaaggtgcgtacgagttccgcagcgctgttcgccaagagaagggggcggac
gggtttgaattacaggaagaaacgcaccgcttcttggatcgtttttatttggatcgcatc
ggtattcgggtgttgattggccagtatctggccttgcggcaaccgccggtggaaaactac
gtcggtatcatatgctcccatacttcgccttacgaaattgtcaagcgtgccattgatgat
gcggcttttatgtgcacacgcaaatatggtgacgctccggaagtcattatgagtggaaga
ctagatttgacctttccttatgtaccaactcatttgcactatatcatgttggaattgatt
aaaaacagtatgcgtgccactgtggaatggcatggtattgattcgccggaatttccgcct
atcaaggtaattattgccgatggtgccgacaacgaggacgtagtgatcaaggttagtgac
gaaggtggcggaattccccgatccaatatggggaagatttggtcctatcttttcacgacc
gcggatccagccattcaagcgggtatggtcggaaccgctggtgccaaaggacagggccaa
gatcacggaattgactcccctttggctgggctgggctacgggttgccgatttcgagatcg
tactgtcgatactttggtggcgatttaagcatcatgtcaatggaaggattcgggaccgac
gctttcgtgtacttgacgcgattgggcaatacaagtgaacccgtgccaatttag

DBGET integrated database retrieval system