KEGG   Phaeodactylum tricornutum: PHATRDRAFT_51026Help
Entry
PHATRDRAFT_51026  CDS       T01075                                 

Definition
histone deacetylase 1 isoform
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PHATRDRAFT_51026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 426 aa AA seqDB search
MGDSRRVSYFYDAEIGNYHYGQGHPMKPHRVRMTHNLVVNYGLYRKMEVFRPRLVSPTAM
TRFHSDDYINFLRVITPDNMQDYIRPLQRFNVGEDCPVFDGLFEFCQLYTSGSIGGAARL
NENRVDIVINWAGGLHHAKKAEASGFCYVNDCVLAILELLKKHERVLYIDIDIHHGDGVE
EAFYSTNRVMTVSFHKFGEYFPGTGDVLDVGYAQGKNYAINFPLNDGMDDDSYESIFRPV
IGKIMEVFAPGAVVLQCGADSLSGDRLGCFNLSAQGHANCVEFVRSFNIPMLVLGGGGYT
LRNVPRCWTYETSVLTGEKVSDELPFNDYFEYFGPDYRLHLPVSNMENLNSRAYLDKTKN
QLLDILSQVEPVPSVQIQTGQIDSQTNPRSMAMEVDDEPPAEESNPDARVTREDTGRKEH
ASELAA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgggggactctaggcgtgtatcgtacttttacgatgccgagatcggaaactaccattac
ggccaaggccatccgatgaagcctcatcgcgtgcgcatgacgcacaatctcgtcgtcaac
tacggcctctaccgcaagatggaggtctttcgtcctcgtcttgtttcgcccaccgccatg
acgcgttttcacagcgacgactacatcaacttcctccgagtcattacccccgacaatatg
caggattacattcgtcccctccagcgcttcaacgtgggagaagactgcccggtcttcgac
ggtttgttcgagttttgtcagctctacacatccggatcgattggcggcgccgctcggctt
aacgaaaatcgcgtcgatattgttatcaactgggctggcggtctgcatcacgctaaaaag
gccgaagcctccggattctgttacgtcaatgactgtgtcttggccattctcgagcttctc
aagaaacacgaacgagttctatatatcgacattgatattcatcacggagatggagtcgaa
gaagccttttactcgaccaaccgcgtcatgacggtcagttttcacaagtttggcgagtac
tttccaggaaccggggacgtcctcgatgtgggctacgcccagggcaagaactacgccatt
aacttcccgctcaacgacggtatggatgacgattcgtacgaatccatctttcgtccagtg
attggcaagatcatggaagtattcgcaccgggcgctgttgtcttgcaatgcggcgccgat
tcgttatcgggcgatcgtctcggctgctttaatctttcggcacagggccacgctaactgt
gttgagtttgtccgctccttcaatattccaatgctggtgctaggaggcggtggttatacg
ctacgcaatgtaccgcgctgctggacgtacgaaacgtcagtccttacgggagaaaaagtt
tcggacgaattaccctttaacgattatttcgagtactttggaccggattatcggctccat
ttgcccgtctcgaacatggaaaatcttaactcgcgagcctatttggataaaaccaagaat
cagcttttggatatactgagtcaagttgagcccgtgcccagcgtacaaatccaaaccgga
cagatagattcacagaccaaccctcgctctatggcgatggaagtggacgacgagcctcca
gcggaggaatcaaatccggatgcgcgcgtaacgagggaagacactgggcgaaaggaacac
gcgtccgagctggcggcgtaa

DBGET integrated database retrieval system