KEGG   Phaeodactylum tricornutum: PHATRDRAFT_51088Help
Entry
PHATRDRAFT_51088  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00630  Glyoxylate and dicarboxylate metabolism
pti01100  Metabolic pathways
pti01110  Biosynthesis of secondary metabolites
pti01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PHATRDRAFT_51088
Enzymes [BR:pti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PHATRDRAFT_51088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 7202968
NCBI-ProteinID: XP_002182169
JGI: 51088
UniProt: B7G518
Position
15
AA seq 593 aa AA seqDB search
MKFTVASISGSSSASPTSNGATKEDVAKPKIPRGLRALPAAAASSRVSPGSELGMLRSEA
SSIDQWWKDPRWKNTTRVYSSTDVACLRPSAQARNNLRQAPGVSFSSQQSDKLWSLLVQL
QARKGYSHTFGALDPVQVTQMAPHLSSIYVSGWQCSSTASSTNEPGPDFADYPMNTVPNK
VDQLVRAQLHHDRRQQQERSEALLAGKDPGQPVDYLRPIVADADTGHGGLSAVMKLTKLM
VEAGAAGMHLEDQKPGTKKCGHMGGKVLVSTQEHIDRLVASRLASDILGVNLILVARTDA
EAATLLDSNIDGRDHPFILGVTTPGMPTLQDAVAKAPAGQANQVTTEWTKQANLMTFGEA
VLATIQRSSKPAYQKRQMEQRWMASNPNTLSNAQARRMADEILGQANAVNFDWESCRVRE
GYYQLRPGIEYCIQRAIAYAPYADLIWMETKIPAIDDAAQFSRGVHAVHPHQMLAYNLSP
SFNWDASGMTDSQIASFNDDLGRLGYVWQFITLAGFHGNGLVMTKLARAYGDRGMIAYVE
QIQRQERIHKVELLTHQKWSGAELVDQMVNVASGGVSSTAAMGAGVTEAQFGH
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttacggtggcttccatcagtggtagcagcagtgcatctcccaccagcaatggt
gccacaaaggaagacgttgccaagcccaagattccccggggccttcgtgctttgccagcc
gctgccgcgtcgagccgagtttcgcccgggtcggagcttggaatgcttcgatccgaggca
tcttccattgaccagtggtggaaagatccgcgttggaagaataccactcgagtgtactcc
tcaacggacgtggcttgcttgcgtccttcggctcaggcacgcaataatcttcgccaagcc
ccaggcgtgtccttttcttcccagcagtcggacaaactctggagtcttttggtccagttg
caagcccgcaagggctactcgcatacctttggcgcactcgatccggtccaggttacgcaa
atggcaccgcatctcagcagtatttacgtttctggctggcagtgttcgagtacggcgtcg
tcgacgaacgaaccgggtccagactttgccgattaccccatgaacacggtcccgaacaag
gtcgatcagttggtccgggcgcaactgcaccacgatcgacgtcaacaacaggagcgcagc
gaagcacttttggcgggtaaggatccgggacagcccgtcgattacttgcgacccattgtg
gcggacgcggataccggacacggcggcctgtcagcagtgatgaaactcaccaagctcatg
gtggaagcgggtgcggcgggtatgcatttggaagatcagaaacccggcacgaaaaagtgc
ggacacatgggcggcaaagttctggtgtcgacgcaggaacacattgatcgcctcgtggcg
tcacgcttggcctccgatattctcggcgtcaacttgattttggtagcccgtaccgatgcc
gaagcggcaactttgttggatagcaacattgatggccgggaccacccgtttattctcggg
gtcactactccaggaatgccgacgttgcaagacgccgtggcgaaagctcctgctggacag
gccaaccaggtcactacggaatggaccaagcaggctaatcttatgacttttggcgaggct
gtcttggcgacaattcagcgttcatcaaagcccgcctaccaaaagcgccagatggagcaa
cgttggatggcttccaatcccaatacgctcagcaatgctcaagcccgccgtatggcagac
gaaattcttggacaagcgaatgctgtcaatttcgactgggaatcatgtcgggtccgcgaa
ggttactaccagttgcgccctggcattgaatattgcatccaacgtgcaatcgcgtacgct
ccgtacgcagaccttatctggatggaaaccaagattcccgccattgacgatgctgcgcag
ttcagtcgtggcgtccacgctgtacacccccaccaaatgctggcctacaatttgagcccc
agtttcaactgggacgcatcaggcatgacagattcacaaatcgcgtcgttcaatgatgat
ttgggtcgtttggggtatgtctggcagtttatcacactggccggtttccacggcaacggc
cttgttatgacgaaacttgctcgggcgtatggagatcggggtatgatagcttacgtcgag
cagatccaacgccaggaacgcatccacaaagtggagctattgacacatcaaaagtggtcg
ggcgccgagctcgttgaccaaatggtaaacgtcgcatccggaggtgtttcttcgacggcc
gccatgggtgcgggggtgaccgaagctcaattcggtcattaa

DBGET integrated database retrieval system