KEGG   Phaeodactylum tricornutum: PHATRDRAFT_51088Help
Entry
PHATRDRAFT_51088  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHATRDRAFT_51088
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PHATRDRAFT_51088
Enzymes [BR:pti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PHATRDRAFT_51088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
15
AA seq 593 aa AA seqDB search
MKFTVASISGSSSASPTSNGATKEDVAKPKIPRGLRALPAAAASSRVSPGSELGMLRSEA
SSIDQWWKDPRWKNTTRVYSSTDVACLRPSAQARNNLRQAPGVSFSSQQSDKLWSLLVQL
QARKGYSHTFGALDPVQVTQMAPHLSSIYVSGWQCSSTASSTNEPGPDFADYPMNTVPNK
VDQLVRAQLHHDRRQQQERSEALLAGKDPGQPVDYLRPIVADADTGHGGLSAVMKLTKLM
VEAGAAGMHLEDQKPGTKKCGHMGGKVLVSTQEHIDRLVASRLASDILGVNLILVARTDA
EAATLLDSNIDGRDHPFILGVTTPGMPTLQDAVAKAPAGQANQVTTEWTKQANLMTFGEA
VLATIQRSSKPAYQKRQMEQRWMASNPNTLSNAQARRMADEILGQANAVNFDWESCRVRE
GYYQLRPGIEYCIQRAIAYAPYADLIWMETKIPAIDDAAQFSRGVHAVHPHQMLAYNLSP
SFNWDASGMTDSQIASFNDDLGRLGYVWQFITLAGFHGNGLVMTKLARAYGDRGMIAYVE
QIQRQERIHKVELLTHQKWSGAELVDQMVNVASGGVSSTAAMGAGVTEAQFGH
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttacggtggcttccatcagtggtagcagcagtgcatctcccaccagcaatggt
gccacaaaggaagacgttgccaagcccaagattccccggggccttcgtgctttgccagcc
gctgccgcgtcgagccgagtttcgcccgggtcggagcttggaatgcttcgatccgaggca
tcttccattgaccagtggtggaaagatccgcgttggaagaataccactcgagtgtactcc
tcaacggacgtggcttgcttgcgtccttcggctcaggcacgcaataatcttcgccaagcc
ccaggcgtgtccttttcttcccagcagtcggacaaactctggagtcttttggtccagttg
caagcccgcaagggctactcgcatacctttggcgcactcgatccggtccaggttacgcaa
atggcaccgcatctcagcagtatttacgtttctggctggcagtgttcgagtacggcgtcg
tcgacgaacgaaccgggtccagactttgccgattaccccatgaacacggtcccgaacaag
gtcgatcagttggtccgggcgcaactgcaccacgatcgacgtcaacaacaggagcgcagc
gaagcacttttggcgggtaaggatccgggacagcccgtcgattacttgcgacccattgtg
gcggacgcggataccggacacggcggcctgtcagcagtgatgaaactcaccaagctcatg
gtggaagcgggtgcggcgggtatgcatttggaagatcagaaacccggcacgaaaaagtgc
ggacacatgggcggcaaagttctggtgtcgacgcaggaacacattgatcgcctcgtggcg
tcacgcttggcctccgatattctcggcgtcaacttgattttggtagcccgtaccgatgcc
gaagcggcaactttgttggatagcaacattgatggccgggaccacccgtttattctcggg
gtcactactccaggaatgccgacgttgcaagacgccgtggcgaaagctcctgctggacag
gccaaccaggtcactacggaatggaccaagcaggctaatcttatgacttttggcgaggct
gtcttggcgacaattcagcgttcatcaaagcccgcctaccaaaagcgccagatggagcaa
cgttggatggcttccaatcccaatacgctcagcaatgctcaagcccgccgtatggcagac
gaaattcttggacaagcgaatgctgtcaatttcgactgggaatcatgtcgggtccgcgaa
ggttactaccagttgcgccctggcattgaatattgcatccaacgtgcaatcgcgtacgct
ccgtacgcagaccttatctggatggaaaccaagattcccgccattgacgatgctgcgcag
ttcagtcgtggcgtccacgctgtacacccccaccaaatgctggcctacaatttgagcccc
agtttcaactgggacgcatcaggcatgacagattcacaaatcgcgtcgttcaatgatgat
ttgggtcgtttggggtatgtctggcagtttatcacactggccggtttccacggcaacggc
cttgttatgacgaaacttgctcgggcgtatggagatcggggtatgatagcttacgtcgag
cagatccaacgccaggaacgcatccacaaagtggagctattgacacatcaaaagtggtcg
ggcgccgagctcgttgaccaaatggtaaacgtcgcatccggaggtgtttcttcgacggcc
gccatgggtgcgggggtgaccgaagctcaattcggtcattaa

DBGET integrated database retrieval system