KEGG   Phaeodactylum tricornutum: PHATRDRAFT_51406Help
Entry
PHATRDRAFT_51406  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PHATRDRAFT_51406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 297 aa AA seqDB search
DPVLAEWEREHEETTKIKNIESLVLGPYVMDAWYYSPFPKNYSNLKTLYVCEYCLTYMRK
VSSYKHHRAHCTTRQPPGKRIYHQPLPNDEDASYLDVYELDGQDAKLYCQKLCLLAKLFL
DHKTLYYDVTPFYFYVVAKVDDHGSHIVGYFSKEKVSGEGYNLACILTFPPYQKAGFGKF
IISLSYELSKRENKTGSPEKPLSDLGKVSYRSYWTHVLLSVLYEHDPQQDLSIADLSLTT
GIKQEDILSTLQQLEMIKVWKGQHVVYVKQAVLEEYRALNKRFRLCQPECLEWKPPD
NT seq 893 nt NT seq  +upstreamnt  +downstreamnt
gatccggtgctggccgaatgggaacgggaacacgaggaaacaaccaaaatcaaaaacatt
gagtcgctcgtgttgggaccgtacgttatggacgcctggtactacagtccctttcctaag
aattacagcaacctgaaaaccctgtacgtctgtgagtactgtctcacctacatgcgcaag
gtctcgtcctataaacaccaccgagcgcactgtaccacccgccaaccaccaggaaagcgc
atttatcaccaaccgctacccaacgatgaagatgcttcctacttggatgtttacgagctg
gacggacaggatgccaagttgtactgtcaaaagctgtgtctactcgccaaactctttctg
gatcacaagaccttgtactacgatgtaacccccttttatttttatgtggtagccaaggtt
gacgaccatggttcgcacattgtcggctatttctccaaagaaaaggtgtcgggggaaggc
tataatctcgcgtgtatcttgaccttccctccataccaaaaagcgggatttggcaaattc
atcatttctctcagttacgaattatccaaacgggagaataaaactggatcccccgaaaag
cccctatctgatctcggtaaggtctcgtaccgttcgtattggacacacgtcctgttgagt
gttttgtacgaacacgacccgcaacaggatttgtccattgctgatttatctttaacgacc
ggtatcaaacaagaagatattctgtcgactcttcaacaactcgagatgattaaagtttgg
aaagggcagcatgtcgtatatgtcaaacaagcggtgttggaggagtaccgagcactcaat
aagcgctttcgattgtgtcagccagaatgtttggagtggaagcctccggatga

DBGET integrated database retrieval system