KEGG   Phaeodactylum tricornutum: PHATRDRAFT_51700Help
Entry
PHATRDRAFT_51700  CDS       T01075                                 

Gene name
CMK
Definition
4-diphosphocytidyl-2c-methyl-d-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pti  Phaeodactylum tricornutum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PHATRDRAFT_51700 (CMK)
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PHATRDRAFT_51700 (CMK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 355 aa AA seqDB search
MYFASAHVLFLAALSREAVAFTDNRFPIFNHPSAKVTTTSSLSAYTETNESSRGKISERT
LTLFSPCKINLFLRIIRKREDGFHDLASLFQAIGFGDTLELTSIDSDADEFTCNMPGVPV
DNSNLVLRAIQLMREKTGEKQSFRANLIKQVPAQAGLGGGSANAATAMWGVNELMGRPAS
LDQMVEWSGALGSDITFFLSRGTAYCTGRGEIMSSIDPPLPSGTKICIVKIDIGLSTPSV
FKALDYDKLSNLNADDVLLPTFLRGIDQVPDSYFVNDLETPAFKCIPELRSLKEELLGVA
GFDHVMMSGSGTSIFCLGEPKDNKDFHDRFVSRKGLQVFFSEFISRPEGVWFEKP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtatttcgcctcagcacacgtattattcttagcggcactgtctcgagaggctgtagcc
ttcactgacaatcgctttccgatcttcaaccatccgtctgccaaggtcaccacgaccagc
agtctcagcgcttatacagaaacaaatgaatcgtcgaggggaaaaatctctgaaagaaca
ttgacgctcttcagtccgtgcaagatcaatctcttcttgaggataattcgaaaacgagaa
gacggtttccatgatcttgccagtctatttcaagcgattggttttggcgacactctggag
ctgacatcaatcgactccgatgcagacgaatttacatgcaacatgccgggtgttcccgta
gacaactcaaatctagtgctacgagctatccaactaatgcgagaaaaaacgggtgaaaag
caatcctttcgagccaatctgatcaaacaagtacccgcccaagcgggacttggtggggga
tcggcaaacgctgccacggcgatgtggggcgtcaacgaactgatggggcgtcctgcatca
ttggaccaaatggttgaatggtcaggggctcttggaagtgacattacgttctttctgagt
agaggaaccgcatactgtactggtcgcggcgagatcatgtcctccattgatccgcctctt
ccttcaggaacgaagatatgcatagtaaaaatcgatattggcttgtcgacgccatctgtt
ttcaaagcactggactacgataaattgagtaatctgaatgctgacgacgttttattgcct
acttttctgcgaggaattgaccaggtacctgactcttactttgtaaacgacttggagaca
ccggcttttaaatgtattccggagctgcgtagtctcaaagaagaattattgggagtggcc
ggattcgaccacgtgatgatgtcggggagcggtacgagcatcttttgcctgggcgagccg
aaggataacaaggactttcacgacagattcgtaagtcggaaagggctacaggtattcttc
tcggagttcattagtaggccggaaggggtctggtttgagaaaccctag

DBGET integrated database retrieval system