KEGG   Phaeodactylum tricornutum: PHATRDRAFT_52268Help
Entry
PHATRDRAFT_52268  CDS       T01075                                 

Definition
lysophospholipase
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PHATRDRAFT_52268
Enzymes [BR:pti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PHATRDRAFT_52268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
14
AA seq 209 aa AA seqDB search
QSALVVISHGLGDSAEGFADVAETLAMQMPHVKFVLPTAPTQPVTMNMGMSMPSWYDIVG
LDERANENCKGIEISRTRITSILEEEHANTGLPYRRMVLAGFSQGGALSLYTGLQLKAEQ
KLAAVIVMSGYLPAAKTFAVTTGLESVPVLHCHGTQDPVVQFSMAAKSKQRVLEKGGQQY
ELKSYPIPHTVSPAEINDVLKFLQKQLPP
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
caaagcgcgttggtagttatttcgcacggtcttggcgatagtgcggaaggttttgctgat
gtagcggagaccctggcgatgcaaatgcctcacgtaaagtttgtgttaccaacggcccct
acgcagcctgtgacgatgaacatgggcatgtcgatgccgagctggtacgatattgtcggt
ttggacgaacgggcgaacgaaaactgcaaaggtatcgaaatttctcgaactagaatcacg
tccattctagaagaggaacatgccaacactggtttaccctataggcgcatggtactcgct
ggattctctcaaggtggcgccctttccttgtataccggcttgcaattgaaagcagagcaa
aagctagcagcggtaatagtaatgtcgggctatttgccggcggccaagacttttgcagtt
actacaggcttggaaagtgttcccgttctgcattgtcacggaacacaagatccggtagtc
caatttagcatggcggcaaaatcgaaacagcgcgttctggaaaaaggaggccagcaatac
gaattgaaatcatatcccattccgcacacggtcagtcctgccgagataaacgatgtgcta
aagtttctgcagaaacagctcccgccg

DBGET integrated database retrieval system