KEGG   Phaeodactylum tricornutum: PHATRDRAFT_52268Help
Entry
PHATRDRAFT_52268  CDS       T01075                                 

Definition
lysophospholipase
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pti00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
14
AA seq 209 aa AA seqDB search
QSALVVISHGLGDSAEGFADVAETLAMQMPHVKFVLPTAPTQPVTMNMGMSMPSWYDIVG
LDERANENCKGIEISRTRITSILEEEHANTGLPYRRMVLAGFSQGGALSLYTGLQLKAEQ
KLAAVIVMSGYLPAAKTFAVTTGLESVPVLHCHGTQDPVVQFSMAAKSKQRVLEKGGQQY
ELKSYPIPHTVSPAEINDVLKFLQKQLPP
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
caaagcgcgttggtagttatttcgcacggtcttggcgatagtgcggaaggttttgctgat
gtagcggagaccctggcgatgcaaatgcctcacgtaaagtttgtgttaccaacggcccct
acgcagcctgtgacgatgaacatgggcatgtcgatgccgagctggtacgatattgtcggt
ttggacgaacgggcgaacgaaaactgcaaaggtatcgaaatttctcgaactagaatcacg
tccattctagaagaggaacatgccaacactggtttaccctataggcgcatggtactcgct
ggattctctcaaggtggcgccctttccttgtataccggcttgcaattgaaagcagagcaa
aagctagcagcggtaatagtaatgtcgggctatttgccggcggccaagacttttgcagtt
actacaggcttggaaagtgttcccgttctgcattgtcacggaacacaagatccggtagtc
caatttagcatggcggcaaaatcgaaacagcgcgttctggaaaaaggaggccagcaatac
gaattgaaatcatatcccattccgcacacggtcagtcctgccgagataaacgatgtgcta
aagtttctgcagaaacagctcccgccg

DBGET integrated database retrieval system