KEGG   Phaeodactylum tricornutum: PHATRDRAFT_54505Help
Entry
PHATRDRAFT_54505  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PHATRDRAFT_54505
Transcription factors [BR:pti03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    PHATRDRAFT_54505
Mitochondrial biogenesis [BR:pti03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    PHATRDRAFT_54505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 1056 aa AA seqDB search
MKRLWRHIANCKDQDCSVQHCLSSRGVLSHYRRCKDALCPACGPVRETIRKSHEMESQSN
PQGVPSDNRFMGRDDSFGRSSSVTSPTEQEPKRMRTEHRPSAASIKSARSTPVSAPPLKQ
EPPRSIGKGEKVAPSAEKDSKGSVDRSLLESFSVKELETHLRSLERETQLPPAKLKSKCL
DVLKGLMAHQHGWVFNGPVDPVELGLVDYFEIIKKPMDLGTIQKRLESSAYHSIDDFKTD
IFLTFENAMVYNEDGSVVYDMAKQLKVKAESDMKRLVAQLETEDLERRQNERACTLCGSE
KLLFEPPVYFCNGINCQSQRIRRNSHFYIGGNNQYFWCSPCFNELDDKIPIELADLTVMK
NNLKKKKNDEIHEESWVQCDTCERWVHQICGLFNTRQNKEHHSEYCCPKCLLEKRKTVSI
TPAPKPLLAADLPRTTLSEWLERSVTKKVEKRKRELAEERSQNEGISLEEALRQVESGGP
IIIRQVTAMDRKLEVRELMKKRYAHKNYPDEFPFRCKSIVVFQHLDGVDVILFALYLYEH
GEDNPPPNQRTVYISYLDSVHFMRPRKLRTFVYHEILIAYLDYARRRGFATAHIWACPPL
KGDDYIFYAKPEDQKTPRDSRLRLWYIDMLVECQKRSIVGKVTNMYDIYFADPNLDATAV
PYLEGDYFPGEAENIIKMLEEGGGKKLGSVGKKKKSKSSKAQKNKGGNTGTRSTGVDEEA
LIASGILDGTKSLKDLDRDQVMVKLGETIQPMKESFIVAFLNWKDAREEDMIVPEEIEMA
RIEYAAKGDPELVGSKRDAAGNMRDATSKTGANGEPVKVIDDDAEDLDCEFLNNRQAFLN
LCRGNHYQFDELRRAKHTSLMLLWHLHNRDAPKFVQQCVSCSREILSGKRFHCDTCPDYD
LCQDCYKDPKANRGNCTHALKPLAVEADSGQDRSGLSEQERMQRQRNLLLHIQLIEHASR
CSSQTCSSLNCAKMKKYLQHARVCKVKVLGGCKICKKIWTLLRIHAQKCKDTNCPIPQCN
AIREKMRQLQKQQQAMDDRRRLEMNRHMRFSTAGGS
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgactttggagacatattgcaaattgtaaggatcaggactgctctgttcaacat
tgtcttagtagtcgcggcgttctcagccattatcgacggtgtaaagatgcgctctgtcct
gcatgtgggcctgtccgagaaactatacggaaaagtcatgagatggaaagtcaaagcaat
ccacaaggggtaccgtccgacaatcggtttatgggtcgagatgattcgttcggtcggtca
agttccgttacatcgccaaccgaacaggaaccgaagcgtatgagaacagaacatcgccct
agcgcggcgtctataaaatcagcgcgctctacgcctgtgagcgcgcctcctttgaagcaa
gaaccccctcgaagcataggcaaaggtgagaaagtagctccatctgctgaaaaagattcg
aaaggaagtgtcgaccgatcactcctcgagagtttctcggtgaaggagctcgaaactcat
ttgcgatcgctggaacgagagacccaacttcctccggcgaagctcaagtctaaatgtctg
gatgtattaaagggtttaatggctcaccaacacggttgggttttcaatggtccagtcgat
ccagttgagctcggtcttgttgattattttgaaattatcaagaagcccatggacctcggc
accattcaaaagcgtttggaaagtagtgcataccactccatcgatgactttaaaacggat
atcttcttaacttttgagaatgcaatggtgtataatgaggatggttccgttgtctacgac
atggcgaagcagctgaaggttaaagccgaatctgacatgaagagacttgtggcacaactg
gaaacagaagaccttgaaagacgccagaatgaacgcgcgtgcaccttgtgtggttcagag
aaactgttgtttgaacctcctgtttatttttgtaacggaattaattgtcaatcgcagcgg
atccgacgaaacagtcacttctatatcggaggaaacaaccaatacttttggtgtagccct
tgctttaatgaacttgatgataaaattccgattgagcttgccgacttgacagtcatgaaa
aacaatctgaagaagaaaaagaatgacgagattcacgaggagagctgggtacagtgtgac
acttgcgaacggtgggttcaccagatatgtggactttttaacacccgtcagaataaagag
caccacagcgagtactgttgtcctaaatgtttgcttgaaaaacgcaaaactgtttcaata
actccagcgccgaagccattgctggctgcggacttgccgcggactactttatcggagtgg
ctagaacgcagtgtcactaagaaagtggaaaaaaggaagagagaactggccgaagagcgt
tcgcagaatgaggggatatctcttgaagaagctttgcgacaggtagaaagtggcggccca
ataataattcgtcaagttaccgcgatggatagaaagcttgaggttcgcgagctgatgaaa
aagcgatatgcacacaagaattatcctgacgaatttccctttcggtgcaaatcgattgtc
gtttttcagcatcttgacggagttgatgtcattctgtttgcgttgtatctctacgaacac
ggtgaagacaatcctccgcccaaccaacgaaccgtgtacatctcatatctggacagtgtt
cactttatgaggcctcgcaaactccggacctttgtgtaccatgagattctgattgcctat
ttggactacgctaggcgacggggatttgcaactgctcatatttgggcatgcccacctttg
aagggtgacgattacattttctacgctaaaccagaagaccagaagactccgagagattca
cgactgcgcctttggtacattgacatgctcgtagaatgtcaaaaaaggagtatcgtcggc
aaagtaacgaatatgtacgatatttatttcgcagacccgaatttggacgccactgctgtt
ccctatttggagggcgactattttcctggtgaagcggagaatattataaaaatgctcgaa
gaaggtggaggcaagaaacttgggtcagtggggaaaaagaagaaaagcaaatcgtcgaaa
gcgcagaagaataagggaggaaatacgggtactagatccactggagtcgacgaagaagcg
cttattgcgagtggtattctggatggaaccaagagtttaaaggaccttgatcgtgatcag
gtcatggtgaagctgggtgaaacgattcagcctatgaaggaaagttttatagtagcgttc
ttaaattggaaagatgctcgcgaagaagatatgatagtcccagaagaaatcgaaatggct
aggattgaatacgcagcgaaaggtgatccagagcttgttggaagcaaacgtgatgctgct
ggaaacatgagagacgctacgtcgaagacgggcgcgaatggagagcctgtaaaggttatt
gatgacgacgctgaagatctagattgcgagtttttgaacaatcgccaagcattcttgaat
ctttgtcgaggaaaccattatcaatttgacgagctccggcgagcaaagcatacttcattg
atgctcctttggcatctacataacagagatgcaccaaaatttgtgcagcagtgcgtttct
tgcagtcgcgaaatcctcagtggcaaacgttttcactgcgacacgtgccctgactatgat
ctctgtcaagattgctacaaagaccctaaggcaaacagaggtaactgtacgcacgctctt
aaaccactcgccgttgaagctgattccggacaggatcgcagtgggctatcagagcaagaa
cgcatgcaacgccagcgaaacctgttgttacacattcaacttatcgaacacgcttcaagg
tgttcctctcagacatgttcttcattaaattgcgcaaaaatgaaaaaatatctgcagcat
gctcgtgtctgcaaggttaaagtattaggagggtgcaagatttgcaaaaagatctggacc
ttactccgaattcatgcgcagaaatgtaaggatacaaattgccccattccacaatgcaat
gcgattcgtgagaagatgaggcaactgcaaaagcagcagcaggctatggacgaccggcgc
cgtctggaaatgaatcgtcacatgcgtttctccaccgcaggaggctcttga

DBGET integrated database retrieval system