KEGG   Phaeodactylum tricornutum: PHATRDRAFT_54528Help
Entry
PHATRDRAFT_54528  CDS       T01075                                 

Definition
enoyl-coa hydratase (EC:4.2.1.17)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pti  Phaeodactylum tricornutum
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHATRDRAFT_54528
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PHATRDRAFT_54528
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PHATRDRAFT_54528
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PHATRDRAFT_54528
Enzymes [BR:pti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     PHATRDRAFT_54528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 385 aa AA seqDB search
MRFTTKVLPSRTANLFVLTLNNPKALHALSLDMMHFFQDILKECYADDSVGALLVKSNTT
GMKTKAFCAGGDVKRVYRSCLEEQDSSVLGQGKPGLDSAEFFRQEYVVNHMMATATKPQI
SLWDGIVMGGGVGISVHGKYRIATENTILAMPETNIGLFPDVGSMFWMPKMLPHSVATYM
ALTGHRLEAADLLYTGIATHYIPSARLDDLESALSTASKSFKPTERAEDFAAPPPMDPHD
SYLAQERPAIDKVFGILSDRSKGVEDVVESLENLNSDFGRKTAGILNTMSPTSLKVTLEG
LRRGKDMSRIGDDLCMEFRMSQACMRIGSDFHDGIRAALVDKDRNPQWQPATLAEVTEQI
VESYFLPLEYEWEIPVTKTKISSNL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcgatttacgactaaagttttaccctctcgcactgcgaatctcttcgtgttgacgctc
aacaatccaaaagccttgcatgcactctcgctcgacatgatgcactttttccaagacatt
ctgaaagaatgctacgccgatgattcggtcggcgctttgctggtcaagagcaacacaacg
ggtatgaaaactaaagcattttgcgccgggggagacgtcaaacgggtctatcggtcgtgc
ttagaagagcaagactctagtgtgttgggacaaggcaagcctggccttgattcggccgaa
ttctttcgacaagaatatgttgtaaatcacatgatggcgacagctacgaaaccacaaatc
agcttgtgggatggaatcgtcatgggtggtggggttgggatctcggttcatggcaagtac
cgcattgccacagagaataccattcttgccatgcctgaaacgaacataggtctctttccg
gacgttgggagtatgttttggatgccaaagatgttgccgcatagtgtggctacttatatg
gccttgacgggacatcggctagaagcggcagatctactttacacaggtattgctactcac
tatataccgtctgcgagattggatgatttggaatccgctcttagcacggcttctaaaagc
tttaaaccaacagaaagagcggaagactttgccgcgcccccaccgatggatccgcacgat
tcatatctcgcacaagagcggccagccatagacaaagtattcgggattctttcggatcga
tcaaaaggagttgaggatgttgtcgaaagtttggaaaatttaaattctgatttcggcagg
aaaacagctggcatactaaacacaatgtcaccaacgagcctcaaagttacactggaagga
ttgcgacgaggtaaggatatgtcgaggatcggcgatgacttgtgtatggagttccgtatg
tcgcaggcctgtatgcggattggcagtgattttcatgacggcatacgcgctgcactagtc
gacaaggaccgcaacccacaatggcaaccagcaacgttagctgaagtgacggagcaaatt
gtagaatcgtactttttacctctcgaatatgaatgggaaatccccgtcaccaagacaaag
atttcatcaaatttgtag

DBGET integrated database retrieval system