KEGG   Phaeodactylum tricornutum: PHATRDRAFT_54536Help
Entry
PHATRDRAFT_54536  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
pti  Phaeodactylum tricornutum
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PHATRDRAFT_54536
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PHATRDRAFT_54536
Enzymes [BR:pti01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     PHATRDRAFT_54536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 859 aa AA seqDB search
MMNGRRGYTEIAAGETEPLRETSTSMISPSRTTDPSPRGRNLVCALVTVGVLLGTTLGWT
RVPEDLDSSVPVGVPDSQDPTAASSTDRSIRYRPLCQFYDDTSTSVRMIQTSLKEPSRQW
SDQPCFPASRHTTLFTNQRGRPPVLPLDAYGSPDAILRVNFSAVAFPTHQTPILGFGGAF
TEASGRNYQRLSEQGKQAVMELLFGAQGLGYALGRVHINSCDFSVKSYTFDDVEDDFPLD
HFDVGVHHDVEVGMVDMALRATSILRQGWPSEDAYEGNLRLYASPWSPPAWMKKPTWEDA
KNATHAAKMTYSAEPTCLREGVGSQSRYAASWALYFSKFVTAYRDLGLPLWGVTVQNEPE
FAAPWEACAYTPTTQHDFLTNHLGPQLERDHPDLKIFMFDHNKDHINIWGQKMLNASSNA
SRYVDGTAYHWYAGGMDRLLDGALGNANLHQFQEDMQTYGIQSNHILFNSEACHCPTTGY
AGGDINIYWARAERYAHTILADLAAGSHGWVEWNLLLDSIGGPNHLGNLCESSLLAVPHR
ALNADPHTPPLPDFETDGPMGKVNIGDGRTREELNALGFPAKFLDVGVAVQPIYYYMGHI
SRYVRPGSVAVPGLVTANAQPGVRIFRPSGQVVVGGGENDLARHGMEITAWPCEGSTRQH
FTWNADSKRHIQVQGHDWLGNPTKSCFARKSDPSLGTMSLTDCKPGQVGIYDIVPIAEKE
GDQRFFQIVLTNHPKLDRPCLIIHQLGNDGGAYGPRGGAPVTLGSCSSKAARWKVDETTG
EASSTFFSDDDGNENEVCMTTGWPFLQMGAFLTPNGEVPKTVVILNEAKESANFAIQDQD
KVIVTASIPPRSIQTILLQ
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatggacgtcgtggatacaccgaaattgcggccggcgagaccgaacccttgcgg
gagacttccacttccatgatttccccgtctcgcacaacggatccgtctccccggggacga
aatttggtctgtgcattggtgacggttggtgtcctcctgggaaccactttgggatggacc
cgcgttccggaagacctcgactctagcgtccccgtcggagtgcccgattcacaggatccc
acggccgcctcctccacggaccgttccatccggtaccgtccgctttgtcagttttacgac
gacacgtctacttccgtacgcatgattcaaacttccctcaaggaaccgtcgcggcagtgg
tccgatcagccatgtttcccggcatcccggcacactacattgtttaccaaccagcgtggg
cgtccgccggttttgcccttggacgcctacggctctcccgacgcaatactacgtgtcaac
ttttccgcggttgcatttcccacacaccagacgcccatcctaggattcggtggcgccttt
accgaagcctccgggcggaattatcaacgcctttccgaacagggcaagcaggccgtcatg
gaactgttgttcggggcgcaaggactgggatacgcattgggacgggtccacatcaattcg
tgtgatttctccgtcaaaagctacacctttgacgatgtcgaggacgatttccccctcgac
cactttgacgttggtgtccaccacgacgtcgaagtgggtatggtggatatggccttgcgc
gccacgtcaatcttgcgtcaaggctggccgagtgaggacgcctacgaaggaaatttgcga
ctctacgctagtccctggtcaccgccggcttggatgaaaaaaccgacatgggaggacgcc
aagaacgccacgcacgccgcaaaaatgacctacagcgccgaacccacctgtctgcgcgag
ggcgtcggttcccaatcccgctacgccgcttcctgggccctctatttctccaaatttgtc
actgcctaccgagacttgggattgccgctctggggcgtgacggtacagaacgaaccggaa
ttcgccgcaccatgggaagcgtgtgcctacacaccgaccacccagcacgattttctcacc
aaccatttgggtccacaacttgaacgagatcatcccgatctgaagatattcatgtttgat
cacaacaaggatcacatcaatatttgggggcagaaaatgctcaacgcgtcgagcaatgcg
tcccgttatgtggacgggaccgcctaccactggtacgctggaggtatggaccgtctcctc
gacggtgctctgggtaacgccaatctacaccagtttcaagaggacatgcaaacctacggg
atccaatcaaaccacattctcttcaattccgaagcgtgccactgcccaaccactggctac
gccggtggcgacattaacatttactgggcgcgggcggagcgctacgcccacacgatactg
gccgacctggcggctggtagtcatggttgggtggaatggaatctactcctcgacagtatc
ggcggacctaatcatctagggaacttgtgtgagtcgtcccttctggccgtcccccaccgc
gctttgaacgcagatccccatacaccacctctgcccgactttgaaaccgacgggcctatg
ggcaaggtgaatatcggagacggtaggactcgggaagaactcaacgctcttggttttccc
gccaagtttctagacgttggcgttgccgttcagccaatttactactacatgggacacatc
tcgcgctacgttcgaccgggatcggtagcggtgcccgggctcgtcacggccaacgcgcaa
cctggcgtccggatattccggccatccgggcaagtggtggtcggcggcggggagaacgat
ttggctcggcacggtatggagattacggcctggccgtgtgaagggtccacccgacagcac
tttacctggaacgccgattcgaagcgacatattcaggtacaagggcacgactggcttggg
aatccaaccaagtcctgttttgcccgtaaatccgacccctcgctgggcacgatgagtttg
acggattgcaaaccgggacaagtgggaatctacgatattgttccaatcgcggagaaggaa
ggcgatcaaagattcttccaaattgttttgacgaatcatcccaaactcgatcgaccctgt
ttgatcatccaccaattgggcaatgacggcggagcttatggtccccgaggtggggctccc
gtcaccttgggtagctgttcatcgaaagcagccaggtggaaagtggacgagacaacaggc
gaagcctcgtctaccttcttctcggacgatgacggcaacgaaaatgaggtgtgcatgacc
acaggttggccctttctacaaatgggagctttcttaacgccaaacggggaagtgcctaag
acggtagtgattctcaacgaagccaaagaatcggccaattttgctattcaagatcaagat
aaggttatcgtcacagcttctattcctccgcgatccatccagactatccttttgcagtaa

DBGET integrated database retrieval system