KEGG   Phaeodactylum tricornutum: PHATRDRAFT_54738Help
Entry
PHATRDRAFT_54738  CDS       T01075                                 

Gene name
TIM_1
Definition
isomerase triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHATRDRAFT_54738 (TIM_1)
   01230 Biosynthesis of amino acids
    PHATRDRAFT_54738 (TIM_1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHATRDRAFT_54738 (TIM_1)
   00051 Fructose and mannose metabolism
    PHATRDRAFT_54738 (TIM_1)
   00562 Inositol phosphate metabolism
    PHATRDRAFT_54738 (TIM_1)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PHATRDRAFT_54738 (TIM_1)
Enzymes [BR:pti01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PHATRDRAFT_54738 (TIM_1)
Exosome [BR:pti04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PHATRDRAFT_54738 (TIM_1)
  Exosomal proteins of bladder cancer cells
   PHATRDRAFT_54738 (TIM_1)
  Exosomal proteins of melanoma cells
   PHATRDRAFT_54738 (TIM_1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 268 aa AA seqDB search
MPRPDGSSTPAAEGERKYLVAGNWKCNGTLASNEELVKTFNEAGPIPSNVEVAICCPSVY
LPQLLSSLRDDIQIGAQDCGVNDKNGAFTGEIGAFQIKDIGCDWVIIGHSERREGFEMPG
ETPDLCAKKTRVAIDAGLKVMFCIGEKKEQREDGTTMDVCASQLEPLAAVLTESDWSSIA
IAYEPVWAIGTGLTATPEMAQETHASIRDWISQNVSADVAGKVRIQYGGSMKGANAKDLL
EQPDIDGGLIGGASLTADFFNVVNGAPK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgccctgacggatcgtctacccctgctgcggaaggagaacgcaagtatcttgtt
gccggcaattggaagtgcaacggaacccttgcctcaaatgaggaactcgtcaaaaccttc
aacgaggctggaccgatcccttccaacgtggaagtagcgatttgctgcccttcagtgtat
cttcctcagcttctcagctcgcttcgtgacgatatccagatcggggcacaggattgtggc
gtcaacgacaagaacggagccttcaccggtgaaatcggcgcctttcagataaaggatatt
ggttgcgactgggtcatcatcggacactccgaacggcgtgaaggatttgaaatgccggga
gaaacccctgatctttgcgccaagaaaacccgtgttgccatcgatgccggcctcaaagtc
atgttctgcatcggggaaaagaaggaacagcgcgaggacggcacaacaatggatgtgtgc
gcatctcagttggagcctctcgcggctgttctcaccgaatcagattggtccagtatcgcg
attgcttacgagcccgtgtgggcgattggtacaggcttgaccgcgacacccgaaatggcc
caggagactcacgcgtcgattcgagactggatctcacagaacgtatccgcagacgttgcc
ggcaaggttcgtattcagtacggtggctccatgaaaggtgccaacgccaaagatctgcta
gaacagccggatattgacggcggattgatcgggggtgcatccttgacagctgactttttt
aatgttgtcaatggtgctcccaaataa

DBGET integrated database retrieval system