KEGG   Phaeodactylum tricornutum: PHATRDRAFT_54738Help
Entry
PHATRDRAFT_54738  CDS       T01075                                 

Gene name
TIM_1
Definition
isomerase triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:pti01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pti01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pti00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pti00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pti00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:pti00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 268 aa AA seqDB search
MPRPDGSSTPAAEGERKYLVAGNWKCNGTLASNEELVKTFNEAGPIPSNVEVAICCPSVY
LPQLLSSLRDDIQIGAQDCGVNDKNGAFTGEIGAFQIKDIGCDWVIIGHSERREGFEMPG
ETPDLCAKKTRVAIDAGLKVMFCIGEKKEQREDGTTMDVCASQLEPLAAVLTESDWSSIA
IAYEPVWAIGTGLTATPEMAQETHASIRDWISQNVSADVAGKVRIQYGGSMKGANAKDLL
EQPDIDGGLIGGASLTADFFNVVNGAPK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgccctgacggatcgtctacccctgctgcggaaggagaacgcaagtatcttgtt
gccggcaattggaagtgcaacggaacccttgcctcaaatgaggaactcgtcaaaaccttc
aacgaggctggaccgatcccttccaacgtggaagtagcgatttgctgcccttcagtgtat
cttcctcagcttctcagctcgcttcgtgacgatatccagatcggggcacaggattgtggc
gtcaacgacaagaacggagccttcaccggtgaaatcggcgcctttcagataaaggatatt
ggttgcgactgggtcatcatcggacactccgaacggcgtgaaggatttgaaatgccggga
gaaacccctgatctttgcgccaagaaaacccgtgttgccatcgatgccggcctcaaagtc
atgttctgcatcggggaaaagaaggaacagcgcgaggacggcacaacaatggatgtgtgc
gcatctcagttggagcctctcgcggctgttctcaccgaatcagattggtccagtatcgcg
attgcttacgagcccgtgtgggcgattggtacaggcttgaccgcgacacccgaaatggcc
caggagactcacgcgtcgattcgagactggatctcacagaacgtatccgcagacgttgcc
ggcaaggttcgtattcagtacggtggctccatgaaaggtgccaacgccaaagatctgcta
gaacagccggatattgacggcggattgatcgggggtgcatccttgacagctgactttttt
aatgttgtcaatggtgctcccaaataa

DBGET integrated database retrieval system