KEGG   Phaeodactylum tricornutum: PHATRDRAFT_54738Help
Entry
PHATRDRAFT_54738  CDS       T01075                                 

Gene name
TIM_1
Definition
isomerase triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHATRDRAFT_54738 (TIM_1)
   01230 Biosynthesis of amino acids
    PHATRDRAFT_54738 (TIM_1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHATRDRAFT_54738 (TIM_1)
   00051 Fructose and mannose metabolism
    PHATRDRAFT_54738 (TIM_1)
   00562 Inositol phosphate metabolism
    PHATRDRAFT_54738 (TIM_1)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PHATRDRAFT_54738 (TIM_1)
Enzymes [BR:pti01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PHATRDRAFT_54738 (TIM_1)
Exosome [BR:pti04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PHATRDRAFT_54738 (TIM_1)
  Exosomal proteins of bladder cancer cells
   PHATRDRAFT_54738 (TIM_1)
  Exosomal proteins of melanoma cells
   PHATRDRAFT_54738 (TIM_1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 268 aa AA seqDB search
MPRPDGSSTPAAEGERKYLVAGNWKCNGTLASNEELVKTFNEAGPIPSNVEVAICCPSVY
LPQLLSSLRDDIQIGAQDCGVNDKNGAFTGEIGAFQIKDIGCDWVIIGHSERREGFEMPG
ETPDLCAKKTRVAIDAGLKVMFCIGEKKEQREDGTTMDVCASQLEPLAAVLTESDWSSIA
IAYEPVWAIGTGLTATPEMAQETHASIRDWISQNVSADVAGKVRIQYGGSMKGANAKDLL
EQPDIDGGLIGGASLTADFFNVVNGAPK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgccctgacggatcgtctacccctgctgcggaaggagaacgcaagtatcttgtt
gccggcaattggaagtgcaacggaacccttgcctcaaatgaggaactcgtcaaaaccttc
aacgaggctggaccgatcccttccaacgtggaagtagcgatttgctgcccttcagtgtat
cttcctcagcttctcagctcgcttcgtgacgatatccagatcggggcacaggattgtggc
gtcaacgacaagaacggagccttcaccggtgaaatcggcgcctttcagataaaggatatt
ggttgcgactgggtcatcatcggacactccgaacggcgtgaaggatttgaaatgccggga
gaaacccctgatctttgcgccaagaaaacccgtgttgccatcgatgccggcctcaaagtc
atgttctgcatcggggaaaagaaggaacagcgcgaggacggcacaacaatggatgtgtgc
gcatctcagttggagcctctcgcggctgttctcaccgaatcagattggtccagtatcgcg
attgcttacgagcccgtgtgggcgattggtacaggcttgaccgcgacacccgaaatggcc
caggagactcacgcgtcgattcgagactggatctcacagaacgtatccgcagacgttgcc
ggcaaggttcgtattcagtacggtggctccatgaaaggtgccaacgccaaagatctgcta
gaacagccggatattgacggcggattgatcgggggtgcatccttgacagctgactttttt
aatgttgtcaatggtgctcccaaataa

DBGET integrated database retrieval system