KEGG   Phaeodactylum tricornutum: PHATRDRAFT_54801Help
Entry
PHATRDRAFT_54801  CDS       T01075                                 

Gene name
CHC
Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
pti  Phaeodactylum tricornutum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pti00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PHATRDRAFT_54801 (CHC)
Exosome [BR:pti04147]
 Exosomal proteins
  Proteins found in most exosomes
   PHATRDRAFT_54801 (CHC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
15
AA seq 1702 aa AA seqDB search
MAATPITFTEALNLQQLGVPEAAIKHGKTTMESDRFIVAVEEAQVTMIDLRNNAAVERKA
MKAEAAIMNPGEQRILALRSGVNVQIFNLDTRQKLKSHQLTEPCVYWKWTSNSNLAMVTA
SAVYHWSLEGDSAPQQVFDRHPSLQNAQIINYRVSQDGKWCVLGGIAPGANGVVNGSMQL
YNFEKKLSQPLQGHAAAFAVLKIPGRDDPAQVIVFHEKKHDSPEPPKLYVREVGRTAGPP
YGVQPVQIPVPQDGANDFPVSLAIVEKDSLAYMMTRMGYVYVFDAMSAKTVFRNRVTQET
VFLSVAQESTGAVFGITVRRGQVFRLQVNNQALIPYVLNTLNDEDLALKLAGRLNLPGAE
NLQARAFERLLQQGNVAEAARIVAGSGSALRTPATIARFQQIPAQPNQVPPLLQYFSILL
ETGTLNEQESIEVAKPVLQQQRIPLMEKWLKENKLTSSESLGDLIMPHDTGMALSVYLRA
ECHGKAIQCFVQRGEYDKIVSYASSVGFQMDYTQMLNQLLFSNPAGALDLAKGLATAEAF
LSSNRLQETTAFLLEALKENKPEHAFLQTKLLEINLLSGAPQVADAIMQQGMLTHYDRPH
VGKLCERAQMWQRAAEHYTEIADIKRVFKNSHQMSPEFVVEYFGKLNREQSIMLLKDMMG
RGPQNMQVCVEVAKKYHEELGSEQLVQVFESNRATEGLYYYLGAIVNSSEDPFVHFKYIQ
ASCMLGQFKEAERVCRDSTVYIAEEVKEYLKGAKLPDPRPLIHVCDRHGFVDELTEYLYL
NSLLQYIEVYVTKVSPTKTPMVVGKLFDLGANEDFIKRLLMAVGTACPVDELVEIAETRN
RLRLLQPWLEARVATGSTEPGTHDALGKIYITLNRDPKAYLLNNMFYNPKVLGPYCEALD
PQLAFIAYKRGAGECDDELIKVSHDHGLYRDLAQYLVERQDLVLWGKVLNKEEGKEDEED
PQRRQLIDQVVEWALPESTNADEVSCTVKAFMAADLPSELINLLERIVLQGSDFSDNKNL
QNLLILTAIRADASRVAGYVDQLDNFDAKDIALICVSESHMLYEEGFSIYTKFSKPEFTQ
DKDEQVEMQVLAIGVVVDNMKDLDRAKTYATQCDEKPVWSKLGKAQLEGKFAADAIESFI
NADDPSEYVMVCAEANEAEIWMELIPYLKMARKTMQENLVDTELIYSYAKTNNLTELEQF
VTGPNVSNIQSIGDRCFNEGLYQAAKILFISINNNSKLALCHIHLEEYREAVEAAKKANN
VSTWKAVCFACLRADEFRLAATCGLEVIKYPDHLDEVVTHYSDLGHFDHLISLFEQGIGL
EDAHIGIFTELGILYTKHIPEKVMDHCKVFFTKLNVSKVVRACERARMYKPAVYLYMQDK
QHDNAIKTMIERAPAWENDLFLDAVTKIRNAELTYKAIAYYLSMHPNLFTRLMEVMEDTA
DHSRVVSQLRRTGDWALQLGQPYMKSVQKGNLSQVNEALNELYVDDEDYESLRKSIDSFN
NFNMIALASKLSTHELLEFRRISAYVYRRNKKWSQSIELSKNDRMWKDCIDTANESEDAE
IIEGLLRFFCETSEKECFCACLYTCFSHISPDVVLELGWVNGYHHFIMPFLIQNLRQTYS
RLKKLEERTAPPKEDANAQDGIAATYGNLSGFGGGMLMLENGGGMGSPMGGPGIDMSGFG
TAQQPQMGGMPNGSMPGAVPYM
NT seq 5109 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaactcctattacctttacggaggccttgaacctgcaacaactcggagttccc
gaggcagcgatcaagcatggaaaaacaaccatggaaagtgatcgtttcattgtggccgta
gaagaagcccaggtcaccatgattgacttgcgcaacaacgccgcggtggagcgcaaggcc
atgaaggcggaagccgcgattatgaacccgggagaacaacggatcttggcgctgcgctcg
ggagtcaacgttcaaatctttaacctcgacacccgacaaaagctcaagtcccaccagctc
accgagccttgtgtctactggaaatggacgtccaactccaacttggccatggtgacggct
tccgcggtctaccattggtccctcgagggagatagtgctccccagcaagtctttgatcgt
catccgtccctccaaaacgcacaaatcatcaattaccgagtctcacaggacggcaaatgg
tgtgtgcttggaggtattgctcccggtgccaacggcgtcgtgaacggtagtatgcagctc
tacaactttgaaaaaaaactctcgcagccacttcagggtcacgctgcggcctttgccgtc
ctcaagattcccggtcgcgacgatcccgcccaagtcattgtctttcacgaaaagaagcac
gacagtccggagccacccaagctgtacgtccgcgaagtcggacgcacggcggggccgccc
tacggagtccaacccgtccagattccggtccctcaagacggagccaacgactttcccgtc
agtctcgccattgtggagaaagattcgttggcctacatgatgacccgcatgggatatgtt
tacgtctttgacgccatgtctgccaagacggtcttccgcaaccgcgttacccaagaaacg
gtctttttgtcggtcgcacaggaatccaccggggccgtctttggcatcaccgtccggcgg
ggacaagtattccggttgcaggtcaacaaccaagcattaatcccctacgtcttgaacacg
ctcaacgatgaagatcttgccctcaagttggccggacggttgaacctgcccggtgccgag
aacttgcaggcccgtgcatttgagcgtttactgcagcaaggcaacgttgcggaagccgcc
cgtattgtggcaggctcgggttcggcgttgcgcacgcccgcaaccattgctcgctttcag
caaatccccgctcagcccaaccaggtcccacctctccttcaatacttttccatcctgctg
gagacgggcaccttgaacgaacaagagtcgattgaagtcgctaagccagttttgcagcag
caacgaatcccgctgatggagaagtggctcaaggaaaacaagctcacttcctcggaatcg
ctaggtgatttgatcatgccgcacgataccggcatggccttgtcggtgtacctgcgtgcg
gaatgtcacggcaaggccattcaatgctttgtgcagcgtggtgaatacgacaagattgtt
tcgtacgctagttcggttggcttccaaatggactacacgcaaatgttgaaccagctgctt
ttctccaatcccgcgggggcgctggatctcgccaagggactggctactgcggaagccttc
ttgagcagcaatcgtcttcaggagacgacggcctttttgctcgaagctctgaaagaaaac
aagcccgagcatgctttcttgcagactaagttgcttgagatcaacttgctcagtggtgct
ccgcaggttgcggacgccattatgcagcagggaatgttgacccactacgatcgcccgcac
gtgggtaagttgtgtgaacgggctcagatgtggcagcgtgccgccgagcactacaccgag
attgccgatatcaaacgtgtgtttaagaactcgcaccaaatgagccccgagtttgtggtc
gagtattttggtaagctcaaccgtgagcagtcgatcatgttgctcaaggatatgatgggc
cgcggcccgcagaacatgcaagtctgcgttgaagttgcgaagaagtatcacgaagagctg
ggatcggagcaattggtccaggtgtttgaatccaaccgcgcgacggaaggtctctactat
taccttggtgccattgtcaatagttcggaggacccctttgttcatttcaagtacatccag
gcttcgtgtatgctcggccaattcaaggaagccgaacgcgtctgtcgcgattctaccgta
tacattgcggaagaggtgaaggaatacctcaagggagctaagcttcccgatcctcgtccg
cttattcacgtgtgtgaccgccacggattcgtggacgaattgacggaatacctctacttg
aactcacttttgcaatacattgaagtatacgttaccaaggtgtctccgacgaagactcca
atggtggtcggaaaacttttcgacttgggtgctaacgaggactttatcaagcgtttattg
atggccgtcggaactgcctgtccggtggacgagctagtggaaattgccgaaacccgcaat
cgcctgcgtttgttgcagccttggctcgaggcgcgtgttgccactggaagcaccgaaccg
ggaacgcacgacgcgcttggaaagatctacattacgctcaaccgcgaccccaaggcgtat
ctgctcaacaacatgttctacaatcccaaggtcctgggaccgtactgcgaagcgttggat
ccgcagttggctttcatcgcctacaagcgtggtgccggtgagtgcgacgacgagctcatc
aaagtcagtcacgaccatgggctgtaccgggatttggcgcagtacttggttgagcgacag
gacttggtgctgtggggcaaggtgctcaacaaggaagaaggcaaagaagatgaggaagat
cctcagcgacgtcaacttatcgatcaagtcgttgaatgggctcttccagaaagcaccaat
gctgacgaagtttcctgcacagtcaaggccttcatggcagccgacttgcctagcgagctc
atcaacctgttggagcggattgtcctacagggttcggacttttccgacaacaagaacttg
cagaatttacttatccttacggccattcgtgctgatgccagccgcgtcgcggggtacgtt
gatcagctcgacaactttgacgcgaaggatattgctcttatttgtgtgtcggagagtcac
atgctctacgaagaaggtttcagtatctacaccaagttttcgaagcccgaattcacgcag
gacaaagatgaacaggtagaaatgcaggtgctagcgattggcgttgtcgttgacaacatg
aaagacttagaccgtgccaagacgtacgctacgcagtgtgacgaaaagcctgtctggtcg
aagctcggtaaggcccagctagaagggaagtttgccgcggatgctattgaatccttcatc
aatgctgatgacccgagcgaatatgtcatggtttgcgctgaagccaacgaggccgagatc
tggatggaactcattccttacctcaaaatggctcgcaaaactatgcaagagaacttggtt
gatactgagttgatttactcgtacgccaagacgaacaatctcacagagcttgagcaattt
gtcactggaccgaatgtttcgaacattcaatccatcggagatcgttgtttcaacgaaggt
ttgtaccaggcagcgaagattttgtttatcagtatcaacaacaactcgaagttggccctg
tgtcatatccatttggaagagtaccgggaagccgttgaagctgccaaaaaggccaacaat
gtatcaacatggaaggctgtatgctttgcctgtttgagagctgatgagttccgactggct
gctacatgtggtctcgaagttattaagtatcccgaccacttagacgaggttgtcacccac
tactccgatctcggtcacttcgatcatttgatttctttgtttgagcaaggaattggtttg
gaagatgctcacattggcatcttcaccgaacttggcattttgtacacgaagcatattccg
gagaaggtcatggatcattgcaaggtcttctttaccaaactcaacgtatcgaaggtagtc
cgcgcttgtgagcgagcccgtatgtacaagcctgctgtgtatctgtacatgcaagataag
cagcacgataacgctatcaagaccatgattgaacgtgcccctgcgtgggaaaacgatctc
tttttggatgcggtcaccaagatccgcaatgccgaactcacgtacaaggctatcgcctat
tacttgtcgatgcatcctaatctctttacccgactgatggaagttatggaggataccgcc
gatcactctcgtgtagtgagtcagttgcgacgcacaggcgattgggctttacagcttggt
caaccgtacatgaaatctgttcagaagggtaacctgagccaggtgaacgaggccctgaat
gagctctacgtggatgatgaggactacgaatcccttcgcaagtcgatcgatagtttcaac
aatttcaacatgattgcactagcgtcaaagctctccactcatgagcttcttgagttccga
cgtatatctgcttacgtttaccgtcgcaataagaagtggagccagtcaattgaactttcg
aagaatgaccgcatgtggaaggactgcatcgataccgccaatgagtcggaagatgctgaa
atcattgaaggtctgctgcgttttttctgcgaaacatccgagaaggagtgtttctgtgca
tgcctgtacacgtgcttttctcatatttcccccgatgtggtgttggaattgggatgggtc
aacggttatcaccactttatcatgcctttcctcattcaaaaccttcgccagacgtacagt
cgtctcaagaagttggaagagcgaactgctccaccgaaggaagacgcgaatgcgcaggat
ggcattgcagcgacttacggaaacctgagtggatttggaggtggcatgctcatgttggag
aatggtggtggaatgggatctccgatgggcggaccaggaatcgatatgagtggattcggt
acggcgcaacagccacagatgggtgggatgcccaacggaagtatgcctggcgctgtgccc
tacatgtag

DBGET integrated database retrieval system