KEGG   Phaeodactylum tricornutum: PHATRDRAFT_55086Help
Entry
PHATRDRAFT_55086  CDS       T01075                                 

Gene name
P5CS
Definition
delta l-pyrroline-5-carboxylate synthetase
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
pti  Phaeodactylum tricornutum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHATRDRAFT_55086 (P5CS)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PHATRDRAFT_55086 (P5CS)
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     PHATRDRAFT_55086 (P5CS)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PHATRDRAFT_55086 (P5CS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
23
AA seq 747 aa AA seqDB search
MMLKMQATDFGNSRNECRSRAALRMARRVVIKAGTSVVANDDGSPSLTRLGAIVEQIAAL
NQAGVEVIFVSSGAVGMGKNLLRKQARLNMSFKDLHKSDSHHAHLGSGLHASYAAAGQFE
LMNLYQSLFSPKGVTASQMLLTQADFGDAHHLQNLRYAVDRLLSLGIVPIVNENDAVSVL
PGTTQEAEPVFSDNDSLAALCARTFGAEVLLLLTDVDGVYTLPPTHPKAKLIPFYHANTE
QVGIGVKSAQGRGGMAAKIDAARNAVAPGSACTACVICAGSDLDVVRAVLSKDWDGAETG
KGTLFATPESCSDGARDMALRARREARKLQALPAEVRRNILNAVADALLTRKDEIVQANQ
LDLANAAQDKVAGPLVKRLGLTDEKLATLVTGIRQLATLPDPLGNVKAKRELADGLELSL
TTVPIGVLLIIFESRPDSLPQIASLALASSNGLLLKGGKEAYHSNTALHDVIGDAIEKGS
EGLISKDIIGLVTSRGQVNDLLSLDDTIDLVIPRGSNALVSYIQENTKIPVLGHADGVCH
VYIDASASAEAACRIAVDAKTDYPSACNAMETLLLHADTVENGVALNVLQALRSAGVKCL
GGPKAMKAGLSDVATQKTKHEYGDLTCLVEIVDSIDEAIDWIHENGSGHTEAIVCAPDSP
AGEIFLQKVDAACVFCNTSTRFADGYRLGLGAEVGISTGRIHARGPVGVEGLLTTKWQLR
SLSGESYLATDFAGADPKRTFTHKNLL
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcaagatgcaagcaaccgactttggcaattcccgcaacgagtgtcgttcgcgt
gcggcgttgcgcatggcgcgacgcgtcgtcatcaaggccggcacttcggtggtggcgaac
gacgacgggtcaccgtcgctcacgcgtctcggcgccattgtggagcagattgcggcactg
aatcaagccggcgtcgaagtcatctttgtgagttccggagccgtcggcatgggcaagaat
ctcttgcgcaaacaggcacgcctcaacatgagcttcaaggatctgcacaagtccgacagt
caccacgcgcacttggggagtggactgcacgcctcctacgcggcggcgggacaattcgaa
ctcatgaatctctaccagagtctcttctcgcccaagggcgtcacggcgtcgcaaatgttg
ctcacacaggcggatttcggggacgcacatcatctgcagaacctacgctacgccgtggat
cgactcctctcgctcggtattgtccccattgtcaacgaaaacgatgccgtatccgtactg
cccggaaccacgcaagaagccgaacccgtcttttccgacaacgacagtctcgcggcgctc
tgcgcccgcaccttcggagccgaagtactcctcctgctcaccgatgtggacggtgtctac
acgctcccgcccacacaccccaaggccaaactcatacccttttatcacgccaacacggaa
caagtcggaatcggcgtcaagagtgcccaaggtcgcggcgggatggccgccaaaattgat
gccgcccggaacgccgtcgcacccggatcggcctgtaccgcctgcgttatttgcgccggg
agtgacctcgacgtcgtccgtgccgtactcagtaaggactgggacggggccgaaaccggc
aagggcactctctttgccacccccgaatcgtgttcggatggggcccgcgatatggccttg
cgggctcgccgagaagcccgtaaactccaggcactcccggccgaagttcgtcggaatata
ctcaacgccgttgccgacgccctgctgacccgcaaggacgaaatcgtacaggccaaccaa
cttgatttggccaacgccgcccaagacaaagtggcgggacctctcgtcaagagactcggc
ttgacggacgaaaaactggccacgcttgtgaccggtattcgccaactcgccacactccca
gatcccctcggcaacgtcaaggccaaacgagaactggccgacggactcgaattgtccctc
accaccgtccccattggcgtactcctcattatctttgaatctcgaccggatagcctaccc
caaattgcctcgctcgcactagcctccagcaatgggctcttgctcaagggcggcaaggag
gcctaccattccaacacggccttgcacgacgttattggagatgccattgaaaaaggcagt
gaaggactcatttccaaagacattattggtctcgtcacgtctcgtggtcaagtcaatgat
ctactctccctcgacgacacgatcgatttggtcattcctcggggttccaacgccctggtc
agctacattcaggagaataccaagattccggttttgggacacgccgacggcgtgtgtcac
gtctatattgacgccagtgcgtcggcagaagccgcgtgtcggattgccgtcgacgccaag
acggactatccctccgcctgcaacgccatggaaaccttgcttttacacgccgacacggtc
gaaaacggcgtcgccttgaatgtcttacaggccctccgctcggccggcgtcaagtgcctc
ggtggccccaaagccatgaaggctggattaagcgacgtggccacccaaaagaccaagcac
gagtacggcgatttgacgtgcctggtcgaaattgtcgacagcatagacgaggctattgac
tggatccacgaaaacggtagtggccacaccgaagcgattgtgtgtgcgccggactcgccc
gccggagaaatttttctacaaaaggtcgacgccgcttgcgtcttttgcaatacctcgacc
cgtttcgccgacggttaccggctcgggctcggcgccgaagtgggtatttccaccggtcgg
attcatgcgcggggacccgtcggagtcgaaggacttttgacgaccaagtggcagttgcgt
agtctgtcgggagaatcttacctggcgaccgactttgccggggccgacccgaaacggacg
ttcacccacaagaatttgctgtaa

DBGET integrated database retrieval system