KEGG   Phaeodactylum tricornutum: PHATRDRAFT_55192Help
Entry
PHATRDRAFT_55192  CDS       T01075                                 

Definition
(RefSeq) hydratase enyol-coa hydratase
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00062  Fatty acid elongation
pti00071  Fatty acid degradation
pti00280  Valine, leucine and isoleucine degradation
pti00310  Lysine degradation
pti00380  Tryptophan metabolism
pti00410  beta-Alanine metabolism
pti00640  Propanoate metabolism
pti00650  Butanoate metabolism
pti01100  Metabolic pathways
pti01110  Biosynthesis of secondary metabolites
pti01130  Biosynthesis of antibiotics
pti01200  Carbon metabolism
pti01212  Fatty acid metabolism
Module
pti_M00085  Fatty acid biosynthesis, elongation, mitochondria
pti_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PHATRDRAFT_55192
   00650 Butanoate metabolism
    PHATRDRAFT_55192
  Lipid metabolism
   00062 Fatty acid elongation
    PHATRDRAFT_55192
   00071 Fatty acid degradation
    PHATRDRAFT_55192
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PHATRDRAFT_55192
   00310 Lysine degradation
    PHATRDRAFT_55192
   00380 Tryptophan metabolism
    PHATRDRAFT_55192
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PHATRDRAFT_55192
Enzymes [BR:pti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PHATRDRAFT_55192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 7199171
NCBI-ProteinID: XP_002185363
JGI: 55192
UniProt: B7GE26
Position
29
AA seq 269 aa AA seqDB search
MHELTNNVVETRAESTAVETKPDLGVGLIRLHRPKALNALCDALFDDLIHAATALDQDDA
IGCLVVTGSTKAFAAGADISEMQTRTFEYAYRTNMFSEWAKFTNVSKPTIAAVNGFALGG
GCELAMMCDILIAGDKAKFGQPEINLGVIPGAGGTQRLTRAIGKAKAMHMCLTGEMMDAA
AAERAGLVAKIYPADELVDEAVKMAAGIASKGRMSVMMAKEAVNASQELPLQEGLRLERR
FFHALFATEDQTEGMSAFLEKRTPEFKHK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagctcacgaataacgttgttgagacccgggcagagtccaccgcagtcgagacc
aaacccgatcttggtgtcggattgattcgtctccaccgtcccaaggcgctcaacgcgctc
tgcgacgccctctttgacgatctgatccacgccgccaccgccttggaccaggacgacgcc
attggttgtctagttgtcaccggatccaccaaggcatttgccgcgggagcggatatttcc
gaaatgcaaacccgcacctttgaatacgcctaccgaacgaacatgttctccgaatgggcc
aaattcaccaacgtttcgaaaccaacgattgcggccgtcaacggctttgccctcggcggc
ggttgcgaactcgccatgatgtgtgacattctgattgccggcgacaaggccaaatttggg
caaccggaaatcaatctgggcgtcatccccggtgccggcggaacgcagcgcttgacccgg
gcgattggtaaggccaaggccatgcacatgtgtctaacgggtgaaatgatggacgctgcc
gccgcggaacgagccggcctcgtcgccaaaatatatccggccgacgaactcgtcgacgaa
gcggtaaaaatggccgcggggatcgccagtaagggacggatgagcgtcatgatggccaag
gaagccgtcaatgcgtcacaagaattaccgctacaagaaggactacggctcgaacgccgc
ttttttcacgcgctcttcgccaccgaggatcaaacggaaggtatgtcggcctttttggaa
aagcgcacgccggaatttaaacacaagtaa

DBGET integrated database retrieval system