KEGG   Phaeodactylum tricornutum: PHATRDRAFT_55192Help
Entry
PHATRDRAFT_55192  CDS       T01075                                 

Definition
hydratase enyol-coa hydratase (EC:4.2.1.17)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pti  Phaeodactylum tricornutum
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:pti01200]
Metabolism; Overview; Fatty acid metabolism [PATH:pti01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pti00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pti00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:pti00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pti00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pti00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pti00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pti00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:pti00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
29
AA seq 269 aa AA seqDB search
MHELTNNVVETRAESTAVETKPDLGVGLIRLHRPKALNALCDALFDDLIHAATALDQDDA
IGCLVVTGSTKAFAAGADISEMQTRTFEYAYRTNMFSEWAKFTNVSKPTIAAVNGFALGG
GCELAMMCDILIAGDKAKFGQPEINLGVIPGAGGTQRLTRAIGKAKAMHMCLTGEMMDAA
AAERAGLVAKIYPADELVDEAVKMAAGIASKGRMSVMMAKEAVNASQELPLQEGLRLERR
FFHALFATEDQTEGMSAFLEKRTPEFKHK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagctcacgaataacgttgttgagacccgggcagagtccaccgcagtcgagacc
aaacccgatcttggtgtcggattgattcgtctccaccgtcccaaggcgctcaacgcgctc
tgcgacgccctctttgacgatctgatccacgccgccaccgccttggaccaggacgacgcc
attggttgtctagttgtcaccggatccaccaaggcatttgccgcgggagcggatatttcc
gaaatgcaaacccgcacctttgaatacgcctaccgaacgaacatgttctccgaatgggcc
aaattcaccaacgtttcgaaaccaacgattgcggccgtcaacggctttgccctcggcggc
ggttgcgaactcgccatgatgtgtgacattctgattgccggcgacaaggccaaatttggg
caaccggaaatcaatctgggcgtcatccccggtgccggcggaacgcagcgcttgacccgg
gcgattggtaaggccaaggccatgcacatgtgtctaacgggtgaaatgatggacgctgcc
gccgcggaacgagccggcctcgtcgccaaaatatatccggccgacgaactcgtcgacgaa
gcggtaaaaatggccgcggggatcgccagtaagggacggatgagcgtcatgatggccaag
gaagccgtcaatgcgtcacaagaattaccgctacaagaaggactacggctcgaacgccgc
ttttttcacgcgctcttcgccaccgaggatcaaacggaaggtatgtcggcctttttggaa
aagcgcacgccggaatttaaacacaagtaa

DBGET integrated database retrieval system