KEGG   Phaeodactylum tricornutum: PHATRDRAFT_55192Help
Entry
PHATRDRAFT_55192  CDS       T01075                                 

Definition
hydratase enyol-coa hydratase (EC:4.2.1.17)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pti  Phaeodactylum tricornutum
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHATRDRAFT_55192
   01212 Fatty acid metabolism
    PHATRDRAFT_55192
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PHATRDRAFT_55192
   00650 Butanoate metabolism
    PHATRDRAFT_55192
  Lipid metabolism
   00062 Fatty acid elongation
    PHATRDRAFT_55192
   00071 Fatty acid degradation
    PHATRDRAFT_55192
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PHATRDRAFT_55192
   00310 Lysine degradation
    PHATRDRAFT_55192
   00380 Tryptophan metabolism
    PHATRDRAFT_55192
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PHATRDRAFT_55192
Enzymes [BR:pti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PHATRDRAFT_55192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
29
AA seq 269 aa AA seqDB search
MHELTNNVVETRAESTAVETKPDLGVGLIRLHRPKALNALCDALFDDLIHAATALDQDDA
IGCLVVTGSTKAFAAGADISEMQTRTFEYAYRTNMFSEWAKFTNVSKPTIAAVNGFALGG
GCELAMMCDILIAGDKAKFGQPEINLGVIPGAGGTQRLTRAIGKAKAMHMCLTGEMMDAA
AAERAGLVAKIYPADELVDEAVKMAAGIASKGRMSVMMAKEAVNASQELPLQEGLRLERR
FFHALFATEDQTEGMSAFLEKRTPEFKHK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagctcacgaataacgttgttgagacccgggcagagtccaccgcagtcgagacc
aaacccgatcttggtgtcggattgattcgtctccaccgtcccaaggcgctcaacgcgctc
tgcgacgccctctttgacgatctgatccacgccgccaccgccttggaccaggacgacgcc
attggttgtctagttgtcaccggatccaccaaggcatttgccgcgggagcggatatttcc
gaaatgcaaacccgcacctttgaatacgcctaccgaacgaacatgttctccgaatgggcc
aaattcaccaacgtttcgaaaccaacgattgcggccgtcaacggctttgccctcggcggc
ggttgcgaactcgccatgatgtgtgacattctgattgccggcgacaaggccaaatttggg
caaccggaaatcaatctgggcgtcatccccggtgccggcggaacgcagcgcttgacccgg
gcgattggtaaggccaaggccatgcacatgtgtctaacgggtgaaatgatggacgctgcc
gccgcggaacgagccggcctcgtcgccaaaatatatccggccgacgaactcgtcgacgaa
gcggtaaaaatggccgcggggatcgccagtaagggacggatgagcgtcatgatggccaag
gaagccgtcaatgcgtcacaagaattaccgctacaagaaggactacggctcgaacgccgc
ttttttcacgcgctcttcgccaccgaggatcaaacggaaggtatgtcggcctttttggaa
aagcgcacgccggaatttaaacacaagtaa

DBGET integrated database retrieval system