KEGG   Phaeodactylum tricornutum: PHATRDRAFT_56467Help
Entry
PHATRDRAFT_56467  CDS       T01075                                 

Gene name
SBPase
Definition
seduheptulose bisphosphatase
Orthology
K01100  
sedoheptulose-bisphosphatase [EC:3.1.3.37]
Organism
pti  Phaeodactylum tricornutum
Pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Class
Metabolism; Overview; Carbon metabolism [PATH:pti01200]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:pti00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 356 aa AA seqDB search
MPEAASGKTASERQEDYKAANSYGASSSSFYTTEEKKESYEALADVLGSKCMDETLRICI
TDMLDVCADITEALRTALVTVEGNINDFGDAQLSVDMIADNLIWDAVKRSTVIREGASEE
DPVVRNVDENKEGEYTVCWDPLDGSSIVDNNWAVGTMIGVWPKSTGLLGATGRDQVTSLV
ALYGPRTTVLVALDDGAYEFSYGCTPEGCQLSDGSWEPWICTRHKIQINHQSKIFSPANL
RAAQELPGYKKLVDHFLENRYTLRYTGGLVPDVYQQFTKGQGVFSNPTAGGSPAKLRLAF
EAAPFGLLVEKAGGKTSDGVTGGSILDVQINSVDQRTALCLGSSDEVNRFNEFVCT
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagcagcttcaggaaagacagcatcggagcggcaggaggattacaaggccgca
aacagttacggggcgtctagtagttcgttctataccaccgaagaaaagaaagaatcgtac
gaagctctcgccgacgttttgggcagcaaatgcatggacgaaacgctaagaatatgcatc
acggatatgttggatgtgtgtgccgatatcacagaagccttgcgcacagctttagtaacg
gtcgagggcaacataaacgacttcggagatgcgcagttgagcgtggatatgatcgccgac
aacttgatttgggacgctgtaaagaggtctacagttatccgggagggtgcttccgaagag
gatcccgttgttcgaaatgtggatgagaacaaggagggcgagtacaccgtctgctgggat
ccactagacggatcgtctattgttgacaataactgggccgttggaaccatgattggtgtt
tggcccaagagtactggccttcttggtgctactggtcgagaccaggtgacttccctcgtg
gccttgtacggtcctcggacaacagtccttgtggccttggacgacggcgcttacgagttt
agttacggctgcacgccagaaggctgccaactgtcggatggcagctgggagccctggatt
tgcacgcgccacaaaatccaaatcaatcaccagagcaaaatcttttcgcccgcaaattta
cgtgccgcgcaagagttgcctggctacaaaaagctagtagaccactttttggagaatcgt
tacaccctacgctacaccggaggtcttgttccggacgtgtatcagcaatttactaaaggg
cagggtgtcttttcgaacccgacggcgggaggtagcccggcgaaattgcgcttggcgttt
gaagcagcgccttttggcttgctcgttgaaaaagctggtggtaagacatccgatggagtc
actggtgggtctattttagacgtacaaatcaattcggtagatcagcgtaccgcattatgc
cttggatctagtgacgaagtaaaccgcttcaatgaatttgtttgcacatga

DBGET integrated database retrieval system