KEGG   Phaeodactylum tricornutum: PHATRDRAFT_56467Help
Entry
PHATRDRAFT_56467  CDS       T01075                                 

Gene name
SBPase
Definition
(RefSeq) seduheptulose bisphosphatase
  KO
K01100  sedoheptulose-bisphosphatase [EC:3.1.3.37]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00710  Carbon fixation in photosynthetic organisms
pti01100  Metabolic pathways
pti01200  Carbon metabolism
Module
pti_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PHATRDRAFT_56467 (SBPase)
Enzymes [BR:pti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.37  sedoheptulose-bisphosphatase
     PHATRDRAFT_56467 (SBPase)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-GeneID: 7196659
NCBI-ProteinID: XP_002177018
JGI: 56467
UniProt: B7FRD1
Position
1
AA seq 356 aa AA seqDB search
MPEAASGKTASERQEDYKAANSYGASSSSFYTTEEKKESYEALADVLGSKCMDETLRICI
TDMLDVCADITEALRTALVTVEGNINDFGDAQLSVDMIADNLIWDAVKRSTVIREGASEE
DPVVRNVDENKEGEYTVCWDPLDGSSIVDNNWAVGTMIGVWPKSTGLLGATGRDQVTSLV
ALYGPRTTVLVALDDGAYEFSYGCTPEGCQLSDGSWEPWICTRHKIQINHQSKIFSPANL
RAAQELPGYKKLVDHFLENRYTLRYTGGLVPDVYQQFTKGQGVFSNPTAGGSPAKLRLAF
EAAPFGLLVEKAGGKTSDGVTGGSILDVQINSVDQRTALCLGSSDEVNRFNEFVCT
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagcagcttcaggaaagacagcatcggagcggcaggaggattacaaggccgca
aacagttacggggcgtctagtagttcgttctataccaccgaagaaaagaaagaatcgtac
gaagctctcgccgacgttttgggcagcaaatgcatggacgaaacgctaagaatatgcatc
acggatatgttggatgtgtgtgccgatatcacagaagccttgcgcacagctttagtaacg
gtcgagggcaacataaacgacttcggagatgcgcagttgagcgtggatatgatcgccgac
aacttgatttgggacgctgtaaagaggtctacagttatccgggagggtgcttccgaagag
gatcccgttgttcgaaatgtggatgagaacaaggagggcgagtacaccgtctgctgggat
ccactagacggatcgtctattgttgacaataactgggccgttggaaccatgattggtgtt
tggcccaagagtactggccttcttggtgctactggtcgagaccaggtgacttccctcgtg
gccttgtacggtcctcggacaacagtccttgtggccttggacgacggcgcttacgagttt
agttacggctgcacgccagaaggctgccaactgtcggatggcagctgggagccctggatt
tgcacgcgccacaaaatccaaatcaatcaccagagcaaaatcttttcgcccgcaaattta
cgtgccgcgcaagagttgcctggctacaaaaagctagtagaccactttttggagaatcgt
tacaccctacgctacaccggaggtcttgttccggacgtgtatcagcaatttactaaaggg
cagggtgtcttttcgaacccgacggcgggaggtagcccggcgaaattgcgcttggcgttt
gaagcagcgccttttggcttgctcgttgaaaaagctggtggtaagacatccgatggagtc
actggtgggtctattttagacgtacaaatcaattcggtagatcagcgtaccgcattatgc
cttggatctagtgacgaagtaaaccgcttcaatgaatttgtttgcacatga

DBGET integrated database retrieval system