KEGG   Phaeodactylum tricornutum: PHATRDRAFT_56602Help
Entry
PHATRDRAFT_56602  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PHATRDRAFT_56602
Enzymes [BR:pti01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PHATRDRAFT_56602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 1479 aa AA seqDB search
MQIDRIIIAFGIVGVTLCGNVVDGLVPVQTRSTRTLLGSVRSARNPAGSRPCHAAPTFTR
LAAVAVHDEDHAVSPQPKKHNTARKPKIVLVAGFESFNRELYSQAARDLDVDLTVFADSD
IRVPPTTTTTTVRDAHDLAVNPDFASAVRQADAFIGSLIFDYDDVLAVQSVLPAVQGPRL
VFESATELMTFNTVGSFSMAPSAEKGGGSAGPPPAVKAILSQFGSGKEEDKLSAYLKLLK
VGPTLLRYVPGEKASDLRTWLEAYRYWNQGGKSNVQAMLALIADRCRDQPSAVLTALPPL
QVTPDIGLIHPVRSRQQQQDETKAAIFTQPQYFESPAEYLAWRLSANTQTLAAQQGFVLA
PDDAPRVAVLLYRKHVITEQRYLGDLIRQMEQDGLLPIPIFINGVEAHTIVRDLLTSNHE
QKLVRDRKLRRDSTYQPSQAVSVDAIVNTIGFPLVGGPAGSMQAGRNVAVAETLLTNMNV
PYVVASPLLLQSIAQWKTNGVLGLQSVVLYSLPELDGAIDTVVLGGLVGDKIALVPERVR
KLNSRVKNWVELRRTPPSERRIAIALYGFPPNVGAVGTAALLDVPRSLDALLRRLEKEGY
RVGDWTSDPNACGESLVAALATLCENPVITAGADRMQEAIESKIARATAGDSTVAATLAL
PGGGLGGAQVVAKDISIDELEEMLGSYMMKKVRRAWSEKDRGPGVTKNGKFAVAGLQLGN
VWIFVQPLLGVEGDPMRLLFERDLTPHPQYCATYEWLRRPKALDGLGTQALIHFGMHGTV
EWLPGQPLGNDRKSWSDELLGGLPNLYVYAANNPSESILAKRRGYGTLVSYNVPPYGRSG
LYLELANLKDLVEEYRSDEGSNGSNRELFETIYDLAQRSGMVNDVPLMCDSKNPFDIDCE
QQSNVLESLPADVCSDWVVRLSDYLNVLQDRLFSSGLHVFGQSPSDEDLVSYLAAYFGEQ
LSESDCRDLVTKWRETSKQSEKSQNVFTSFFQFLEFVAFGETSSDPSFSEQSISERAMTI
AGLLDRSSDELQSVVKGLDGGYIPPAPGGDLLRDGPSVLPTGRNIHALDPYRMPSAGAWA
RGQKAAQEVIRQHQENNEGRFPETIAVTLWGLDAIKTRGESVAIVLALLGAKPVKEGTGR
IVRFDLIPLEELGRPRIDVLASLSGIFRDSFANIVDLLDDTFQRAAQADESDEKNFVKKH
TKELIASGVKDGAAARLFSNPPGDYGSMVNEVIGTGDWEDEESLGETWKGRNVYSYGRKE
GQSGTGGTARPAVLNKLLATTERVVQEIDSVEYGLSDIQEYYANTGALKKAAENRKEIDP
KTGKKRKVSISVIEAFGGFDENALVPVKDVEEVLRLEYRSKFLNPKWRDAMLKQGSGGAY
EISQRMTAMIGWSATAEIDNFVFDQAAERYALDADVAKQLQRANPEAFKNIVRRLLEASG
RGMWSTDTSTLDKLKDLYADADDIIEQGSDFRAKIKQEA
NT seq 4440 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcgaccgtattataatcgccttcgggatcgttggagtgactttgtgtggcaat
gttgttgacgggttggttcccgtgcaaacgaggagcaccaggactctcttggggtccgtg
agaagcgcacggaatccagcaggatccagaccttgtcacgcggcaccaacgttcactaga
ctcgccgccgttgccgtacatgacgaggaccatgccgtgtcaccacagccaaagaagcac
aatactgcccgtaagccgaaaattgtgttggtggccggattcgaatcgttcaatcgcgaa
ttgtattctcaagccgcccgcgacctcgacgtcgacttgacggtcttcgccgactcggac
attcgggtccccccaaccacgacaacgacgacggtacgcgatgcccacgacttggccgtc
aatccagactttgcctccgcggtccgtcaggccgacgcctttataggttcgctcattttc
gattacgacgacgtgctggcggtgcaatcggtcctccccgcggtccaaggaccccgcctc
gtttttgaaagtgccacggaactcatgacgttcaataccgtcggaagcttttccatggca
ccgtcagcggaaaaaggtggtggctctgccgggccaccacccgcggtcaaagccatcttg
tcccaatttggctcgggcaaggaggaagacaagttgagtgcgtatttgaagctccttaaa
gtcggtccaaccttgctgcgctacgtgcccggtgaaaaggccagtgatctacgcacatgg
ttggaagcgtaccgctactggaatcaagggggtaaaagcaatgtgcaggccatgttggcg
ttgattgcggatcggtgtcgggatcaaccgtccgccgtgttgaccgctttaccgcctctg
caagtcactccggatattggtctgatccatccagtgcgtagccgacaacaacaacaagac
gaaacgaaagctgctatctttacccagccacaatactttgaatctccagcggaatacctg
gcgtggcgattgagtgcgaatacccaaacgctagcggcgcaacagggtttcgttttggcc
ccggatgacgctcctcgggtagccgtactcctgtaccgcaaacacgttattacggaacag
cgttatttgggagatctcattcgacaaatggaacaagatggattactgcccatacccatt
tttatcaacggcgtcgaagcgcataccattgtgcgtgatttgttgacgagcaatcacgag
caaaaactggtgcgtgacaggaaactccggcgtgattcgacctatcagccgtcccaagcc
gtttcggtggacgccattgtgaacacgattgggtttcccctggtagggggacccgcggga
tccatgcaagccggacggaacgtggccgtggccgagaccttgctaacaaacatgaacgta
ccttacgtggtagctagtccactattgctccaatctatcgcacaatggaagaccaatgga
gtcttaggattgcagtcagtggttctgtacagcttgcccgaactggacggcgctattgac
actgtcgttcttggcggattggtgggcgataagattgcgctggttccggaacgcgtgcgc
aaattgaactctagggtgaagaattgggtggaactccggcggacgccaccatctgagaga
cgtattgccattgccttgtacggctttccacccaacgtgggagcagtcggtaccgcggcc
ctgctggacgtgccacggtctctagacgccctcctgagacggcttgaaaaggaaggatac
cgtgtgggtgattggacatccgatccgaatgcttgcggagaaagtttagtggcggcgttg
gccaccctgtgtgaaaacccggtcattacagccggcgcggaccgtatgcaagaagcgatc
gagagcaaaattgcccgtgccacggccggagactcgacggtagccgctactctagcgctg
ccgggaggtggactcggaggagcccaggtcgtggcgaaagatatatcgatcgatgaactc
gaagaaatgctgggaagctacatgatgaaaaaagtgcggcgagcctggtctgagaaagat
cgcggtcccggtgttaccaagaatggcaagttcgctgtagcagggctccaacttggaaac
gtgtggattttcgtccagcctttgttaggcgtcgagggtgatcctatgcgtttgctgttt
gaaagagatctgactccacacccacagtattgtgcgacgtatgaatggctacggcgtccc
aaggctctggatgggctagggacacaagcattgattcactttggaatgcacggcactgtg
gaatggcttcccgggcagccgctaggcaatgatcgcaaatcatggagtgatgaattgctt
ggtggcctcccaaatctttatgtgtatgctgcaaacaacccgagcgagagtatcctcgcc
aagcgtcgggggtacggaactctagtgagctacaatgtccctccgtatggtcgaagcgga
ctgtatcttgagctggctaatttgaaagacttggtcgaggaatatcgatcggacgaagga
tccaatggatcgaatcgagaactttttgaaactatttacgacttggcccaaagaagtggt
atggtaaacgacgttccgttgatgtgtgattccaaaaatccttttgatattgattgtgag
cagcagtcaaacgtcctcgagtcgttgccagccgatgtgtgttccgattgggtcgtgcga
ttgtctgattatctgaatgttctgcaagatcgcctgttttccagtggactacacgttttc
gggcaaagcccgtccgacgaagacctggtgtcttatctagcggcttacttcggagagcaa
ctatcggagagcgattgtcgtgatctagtgaccaagtggcgcgaaacatcaaagcagagc
gagaaaagccaaaatgttttcacctctttcttccaatttctcgaatttgttgcatttggg
gaaaccagttcagatccatctttctctgaacaaagcatctccgagcgggcaatgacgatt
gcaggacttctagatcgttcttcggacgaactccaatctgtggtaaagggtttggacgga
ggatatattcctcctgcgccgggaggggatttgttgcgtgatggaccgagcgtgctgcct
accggacgcaacattcatgctcttgatccgtatcgaatgccgtccgctggggcttgggcc
cgcggtcaaaaagcagcgcaagaagtcattcgccagcaccaagagaataatgaaggccga
tttccggaaacgattgctgttacgctctggggtttggatgccatcaaaacacgtggtgaa
tcggtggcgatcgttttagcgttgcttggggcgaagccagtaaaggaaggaactggtcgt
atcgttcggtttgatttgatccctttagaagagcttggccggccaaggattgatgtttta
gcctcccttagtggcatattcagggattcttttgccaacatcgtagacctacttgacgat
acttttcaaagagcagctcaggccgacgaatcagacgaaaagaactttgttaagaagcat
accaaagaactgatagctagtggtgtaaaagatggagctgctgcaagattgttcagcaat
ccaccgggcgactacggaagtatggtgaacgaggttataggaaccggagattgggaagat
gaggagagtttgggagagacatggaaaggacggaatgtttactcttacggtcgaaaagaa
ggacagagcggaactggggggactgctcgtcctgctgttcttaataagttgctggcaacg
accgagcgggtcgttcaagagatcgatagtgtcgagtatggtctttccgacatccaagag
tattacgccaatacaggagcgctgaaaaaagcggcggaaaatagaaaagagattgatccg
aagacggggaagaaacggaaagtatctatatcggtaatagaggcatttggtggatttgac
gagaacgctctggttccggtcaaagatgtcgaggaagtgcttaggttagaataccgaagc
aaattccttaatccaaaatggcgagatgcaatgctaaagcaagggtctggtggagcatat
gaaatctctcaacggatgacagcaatgattggttggtcagcgacggcagagattgataac
tttgtctttgaccaagctgctgaacgttatgcacttgatgctgatgtcgccaaacaactt
caacgcgccaacccggaagcgttcaagaatatagtgaggcggctgcttgaagcttcgggt
agaggtatgtggtcaacggacactagtacgttagataagctgaaggatctttacgccgac
gcggacgacataatcgagcaagggtccgactttcgggcaaagatcaagcaagaagcataa

DBGET integrated database retrieval system