KEGG   Phaeodactylum tricornutum: PHATRDRAFT_8773Help
Entry
PHATRDRAFT_8773   CDS       T01075                                 

Gene name
MARK3
Definition
hypothetical protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
pti  Phaeodactylum tricornutum
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:pti00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    PHATRDRAFT_8773 (MARK3)
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PHATRDRAFT_8773 (MARK3)
Protein kinases [BR:pti01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   PHATRDRAFT_8773 (MARK3)
Mitochondrial biogenesis [BR:pti03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    PHATRDRAFT_8773 (MARK3)
  Mitophagy factors
   Other mitophagy factors
    PHATRDRAFT_8773 (MARK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 511 aa AA seqDB search
MDQAPVQIGQFILGKNLGIGAFGKVKLATHAVTGHKVAVKILNKNKIKQLGMEEKVHREI
NILHLCTHPHIIRLYEVIDTPTDIFLVNEYVSGGELFDYIVSKGRLSADEARNFFHQIIS
GVEYCHFQKIVHRDLKPENLLLDANLNIKIADFGLSNLMRDGDFLRTSCGSPNYAAPEVI
SGHLYAGPEVDVWSCGVILYALLCGSLPFDDESIPNLFKKIKSGMYSLPTHLSQLAKNLI
PRMLEVDPMKRITIAEIRLHPWFQHKLPPYLRHPPELMEKQERIVDQEVIDEVMKLPFHK
AYGNTKGLANGTLNDLRCAYELILDHKHTRLRVMEVARAIQEAASATPPAFSPGGSRGTT
PGGHYGTGGSRYGNTGMIAQHQHGRRTRRWYLGIQSKKDPAHVMTEVYKALMSLGCEWLQ
LSSYRIKCKWRPNTGGSGSSSTIPLAGVIAGEDGHSLRVPNLSTSEYSIKIGLTLYKVQQ
NIYLLDFQKMTGDAFSFMTLCANIITELKSL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggctcccgtacaaataggccagtttatactgggcaagaatttaggaatcggt
gcctttggaaaggtaaaattggcaacacatgccgtaaccggacacaaggtagcggtgaaa
atcctgaacaagaacaaaatcaagcagctgggtatggaggaaaaagttcatcgggaaatc
aatattctgcatttgtgcacgcacccacacattattcgcctgtatgaagttattgacacc
ccaactgatatatttcttgtgaatgagtacgtctctggcggcgagctttttgactacatt
gtttccaaaggccgattgtccgcggacgaggcccgtaatttctttcatcaaattatttct
ggagtggaatattgtcattttcaaaagattgttcatcgtgatctcaagccggagaacctt
ctcttggacgccaatctgaatatcaagattgccgattttggattgtcgaatctcatgaga
gacggtgacttcttgcgtacgtcatgtggatccccaaattacgccgcaccagaagttatc
agtggccatctgtacgccggaccagaagtcgatgtctggtcctgtggtgtcattctttac
gctcttttgtgtggatctcttccgttcgatgatgaatcgattccgaacttgttcaaaaag
atcaaaagtggaatgtacagcttaccaacacatctttcccagttggcgaagaacttgatt
ccgcgcatgttggaagttgatccaatgaaaagaattactattgccgaaattcgtttgcat
ccgtggttccagcataagcttcctccttatttgaggcaccctccagagctgatggagaag
caggagcgaatcgtcgatcaagaagttattgatgaagtgatgaagctaccgtttcacaag
gcttatggcaacacgaaaggtcttgcgaacggtactctcaatgatttgcgatgcgcgtac
gagctaatcctcgatcacaagcacactcgtcttcgcgttatggaagtcgcccgcgccatt
caagaggcggcgagcgcgacgccaccagcgttctcccctggaggatctcgagggacaact
cccggtggtcactatggaaccggcggtagtcgatacggaaatacgggtatgattgcccaa
catcaacacggacggcgaactcgccgatggtatcttggtattcaatcaaagaaggatcct
gcacacgtcatgacggaagtctataaagcgctcatgtcgcttggttgtgaatggttacag
ctatcatcctaccgaatcaagtgcaaatggcgtccaaatactggagggagcggttcgagc
tctacaattcctttggctggggtaattgctggtgaagatgggcatagtttgcgtgtaccg
aatctctcaacctcagaatattcaatcaaaattggtctaactctctacaaggtgcaacaa
aatatttatcttctcgattttcagaaaatgaccggcgacgccttttctttcatgactctg
tgtgcgaatatcataacggagttgaagagtctg

DBGET integrated database retrieval system