KEGG   Phaeodactylum tricornutum: PHATRDRAFT_9283Help
Entry
PHATRDRAFT_9283   CDS       T01075                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PHATRDRAFT_9283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 623 aa AA seqDB search
QISVYYATQTGTSESFARQLEREGPSHGFYVHVVDLEDIGVEDVVDEIQKDQESGISRAV
FLGATYGEGEAPDNATQFVAALAKKAATEMLFQNLKVEELSVPDRCLVGLDFCVFGLGNK
QYDHYNATGKFLDHALERVGGNRILGLGMGDDDGDLEGDFETWKDKKLWPTMERLYVFDK
EALGKRKREAALRVELPDCQYEVHYIDNGDSDFKPMPFDQVHGSSRHYFTAVDCPVTKVQ
ELRSSEEPGSTVHVEIDISSARGLTYATADNLGVLPVNAAETVEAVARALCYDLNAVFYV
KAAPNHEWHGAPFPMPLSIRECLTRYCDLTSAPRRSDLKLLASYAKDPMDQKALLRMSSK
EGRTEYKEKVLASFVGIVDLLKLCPSIEIPLAHFLAVCPLLQTRFFTISSSASVYPNSIH
LTVAVTDALRSDGTMFKGVCSNYLASRVPGKDVIRVYSRPSTFRLPQDSSKPILLIGPGT
GVAPMRALLQERAYQREHLNQSVGQNILYFGCKKRSYDFLYQEEMERFHCEKIIDKLYLA
FSRDGDQKIYVQHLLEQNSEETWRLIHFEGAYVFVCGGVKMGHDVAETLKKIAVSQGSMS
LEGAKSYMTNLAKESRYVQELWA
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
caaatatcggtatactatgctacacaaacggggacttccgaaagctttgcacgccaactg
gaacgggaaggaccatcacatggattctacgtacatgttgtcgatttggaggatattggt
gtcgaggatgttgttgatgagatacagaaagaccaagaatccggaatttcccgagccgtt
ttcttaggggctacatacggagaaggggaagctccagacaacgcgacgcagtttgtggct
gccttggcgaaaaaggctgcgacggaaatgctgtttcaaaatctaaaagtagaggaactc
tctgtaccggacaggtgtctagtcggtttggatttttgtgtgtttggtctcgggaataag
caatacgatcattacaatgcgaccggaaagttccttgaccatgccttggaaagagttggc
ggaaatcggattctcgggctaggtatgggcgatgacgatggcgacttggaaggcgatttc
gaaacttggaaggacaagaagctttggccaacaatggaacgattgtacgttttcgacaag
gaggcgctgggcaagcgcaagcgcgaggccgcccttcgagtggagcttcctgactgccaa
tacgaggtacactacatcgacaatggagattcagattttaagccgatgccatttgatcag
gttcatggatcaagccgtcactactttacggcagtagattgtcccgtgacgaaagtccag
gagcttcgaagctcggaagagccgggctcgacagtgcacgttgaaattgacatttccagt
gccagaggtcttacgtatgcaactgccgacaaccttggtgtgctgcctgtgaacgccgca
gaaactgtagaagcggttgccagggcactttgttacgatttaaatgcagtattctatgtc
aaggcagctcccaatcatgaatggcacggtgcacctttccctatgcccctctcgatccga
gaatgtttgacccgctattgcgacttaacatcagcacctcgacgatctgatctcaagctt
cttgcatcatatgcaaaggaccccatggaccagaaggctctgttacgcatgtcgtcaaag
gaaggccggacagaatacaaggaaaaggttctggcaagcttcgttggaattgtcgatctt
ttaaagctttgcccttcgatcgaaattcccttggcacattttttggccgtttgtcccctg
ctacagactcgcttctttaccatcagctcgtcggcctccgtgtatccaaattcaattcac
ttgacagtggccgtgacagacgcgttacgttccgatggtaccatgttcaaaggcgtgtgt
tccaactatcttgcaagtcgtgtccctggtaaggacgtaataagggtgtatagccgtcca
tcaacattccgcttgcctcaggatagttcgaagccaattttattgattggtcccggtaca
ggagtggcacctatgcgagcgctcttacaagaacgagcgtaccaacgtgagcacctaaac
caatccgtgggacagaatattctttattttggttgtaagaagcgatcttatgattttcta
taccaagaagaaatggagagatttcattgtgaaaagattatcgataagctgtacctagca
ttcagtcgggatggcgaccaaaagatttacgtccaacatttgctggaacagaatagcgaa
gaaacatggagactcattcacttcgagggcgcatacgtttttgtgtgtggtggcgttaaa
atgggccatgacgtagccgagactctcaagaaaattgcggtttcgcaaggctcgatgtca
ctagaaggagcaaagtcctacatgaccaatcttgccaaagaatctcgatacgttcaagaa
ctgtgggcatag

DBGET integrated database retrieval system