KEGG   Phaeodactylum tricornutum: PHATRDRAFT_9413Help
Entry
PHATRDRAFT_9413   CDS       T01075                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PHATRDRAFT_9413
Protein kinases [BR:pti01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PHATRDRAFT_9413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 325 aa AA seqDB search
KTIRFKDLVKFRILGVGTFGKVWLVSHKRTSTPYALKQLSKREIIGHHQVEGVIREKNIM
ASLDHPFVVDLVATFQDERSLYMLIALVQGGELFSVIHTETRDGIPNGNSRFYAACILES
LAHLHHRSICYRDLKPENILIDERGYCVLVDLGFAKIVVDKTYTLCGTPEYLAPEIILSK
GHDKGVDYWAFGVLIYEMLVGRSPFYSYGTDQVSLFKRIVQVKYTFPQGVVHDLARDLIE
RLVVRRQANRLGCLSRGDMDVRDHMWFSIIDVDKLLRKQIPPPWIPRIKDAMDATHFDSY
RHLENEAPSNKPLLSPAQEQQFKDF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
aagacaattcgtttcaaggatctcgtcaagttccgcattcttggagttggaaccttcggg
aaagtatggctagtgagccataagcggacgagcactccttatgccctgaaacagttgagt
aagcgggaaattattgggcaccatcaagtcgagggtgtgattcgagagaagaatattatg
gcatcccttgatcatccttttgtggttgaccttgtcgcgacgtttcaagacgaacgaagt
ttgtatatgctgattgcactagtacagggtggcgagctgttttctgtgattcataccgaa
acaagagatggtatcccgaacggaaactcccgtttttatgccgcttgtattcttgagtcc
cttgctcaccttcaccaccgcagtatttgctaccgtgatcttaaaccagaaaatattctc
attgatgaacggggttactgtgttcttgtcgacctcggtttcgccaagatcgttgtggat
aagacatatacgttgtgcggaacaccagaataccttgcgcctgaaatcatcctttcgaag
ggtcacgacaagggagtcgactactgggccttcggtgttttgatctacgaaatgcttgta
ggtcgctcccctttctattcctacggaacagatcaggtcagtcttttcaagcgtatcgtt
caagtcaaatacacctttccgcaaggtgtcgttcacgacctggctcgcgatttgattgag
aggctggtcgtgcgtagacaagccaatcgactcggctgtctttctcggggcgatatggac
gttcgcgatcacatgtggtttagcatcattgatgtcgacaaacttttgcgcaaacagatt
ccgccgccttggatcccccgcatcaaggacgctatggacgccactcatttcgactcctat
cgccatcttgaaaatgaagcaccatctaacaaaccgctactttccccggctcaagagcag
caattcaaggatttctaa

DBGET integrated database retrieval system