KEGG   Phaeodactylum tricornutum: PHATRDRAFT_9475Help
Entry
PHATRDRAFT_9475   CDS       T01075                                 

Gene name
APC3
Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
pti  Phaeodactylum tricornutum
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:pti00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    PHATRDRAFT_9475 (APC3)
Protein phosphatases and associated proteins [BR:pti01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PHATRDRAFT_9475 (APC3)
Ubiquitin system [BR:pti04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     PHATRDRAFT_9475 (APC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 336 aa AA seqDB search
VRHILELLCSMGKAYQCLRSYNCKEALQILQTLPLRQQATAWVLHQEGRAYLELNEFASA
ERCLEQMQIVDPGRMKGLELLSTVYWQVKKEVELAHLAQRVTDWDRESPEAWCVVGNCFS
LQKDHETALTFFSRSLQLNPNFTYTHTLSGYEYMANEDFVKAIACFRQALRTDDKHYNAW
YGLGAIYQRQEKFDLAEYHFGKAVALHPTSSALRCNLGIAQFSNGKAYQALDTLSEAFHL
DPRNPQARFQRASIYMALHRPEEALSELCKVRDVAPREATVHFSLGKVYKKLGRTKEAMK
CFLTAMDLDPKGSQTIKSALEKLEEPDIDEGTGVGF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtcaggcacatcctcgaactactctgtagcatgggcaaagcttaccagtgccttcgtagc
tataactgcaaggaagcgctgcaaattcttcaaacgctacccttgcgacagcaggcaacg
gcatgggtgctgcatcaggaaggacgtgcttatttggagctcaatgagtttgcatcagcc
gaacggtgcttggagcaaatgcaaatcgtagacccgggccgaatgaaaggattggaactt
ctgagtactgtgtattggcaagtaaagaaggaggttgaactagcccacttggcgcagcgt
gttacagattgggatcgtgaatcgcccgaggcctggtgtgttgttggtaactgtttttca
ttgcagaaagatcacgaaaccgcattgacgttcttctctcgttccttgcaacttaaccct
aacttcacctacacccatactctttctggctacgaatacatggcgaacgaagatttcgtg
aaggcaatagcttgcttccgtcaggctttgcggaccgacgacaaacactacaatgcctgg
tatggtctaggagccatttaccaacgccaagaaaagtttgatctggctgagtatcatttt
ggaaaggctgtcgcgcttcatccaactagcagcgctcttcgatgcaaccttggcattgct
caattttccaatggaaaagcgtatcaagctctcgataccttgtcagaagcctttcacctg
gacccacgaaatccccaggcccgctttcaaagagcttccatctatatggcgctgcatcgc
ccggaagaagcgctttcagaattatgcaaggtacgagatgttgcacctcgcgaagcaact
gtacatttctcgctggggaaagtatataagaagttggggcggacgaaagaggctatgaaa
tgctttttaacagctatggatcttgatcctaaagggagccaaaccatcaagtctgctttg
gaaaagttggaggagcctgacatcgacgagggcacaggcgttgggttctga

DBGET integrated database retrieval system