KEGG   Phaeodactylum tricornutum: PHATRDRAFT_974Help
Entry
PHATRDRAFT_974    CDS       T01075                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PHATRDRAFT_974
Peptidases [BR:pti01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PHATRDRAFT_974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 603 aa AA seqDB search
SGLGNLGNTCFMNSTLQCLAHTHPLKRYFLSGEYGDDLNRNNPLGTGGDLATQFAQLMMD
IWITTAPPRNFLSEASTGYDSSSSLANNVVYPRNFKYTLGKHAERFVGYDQHDSQELATY
LLDALHEDTNLVTKKPYVEKPEQKDTESDQEAADNAWELHLKRENSKVLENFMGQIKSRV
QCCKANCNRVSTTFDPFMYLSVPIPGSMERILKVTYVPMNPQQRMQKLEITISKMATMKE
LFGLLKTIDDLALEDTCAVDIWHQEVYSWYEPKNEVDRIRDNDYTFLYELAPLAMVKAMG
QTVLNGIETDDDVGLGTITKHYQLDLATMTKLNSGDDWSAKLSTYLQNPTMLHNSSRDNC
SELVNTSTNEEDVLDIIERCESSAFLENVRSRHDLAILEFIASKMRKEIVSLENQQTTMY
PDGVIIQIHIRKATLLSGNHRTDECVARKSSNATTVLDCIEKYCQMEQLEDTEMWYCNKC
KDHVRAWKQTHLYRCPPILIVHLKRFQYSSSTHRRDKIGLFIDFPLEGLDLTSVALHWTG
AEKPLYDCYAVSNHYGGLGGGHYTAYALNDDKVWCHYDDSRVTANVEPEEVVSEAAYVLY
YRR
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
tcagggcttggaaacctcggcaatacgtgctttatgaattccacattgcaatgtctggct
catacgcatcccctgaagcgctatttcttgtcaggagaatatggagatgacttgaatcgt
aacaatccgttgggaacgggtggggacttggcgactcagtttgcgcaattgatgatggac
atctggattacaacggctcctccgcgcaactttctttcggaggcctctaccggttatgat
tcttcctcatcactagctaacaacgtggtatatccgcgaaacttcaaatatacgcttggt
aagcatgcggagcggttcgtagggtatgaccaacacgattcgcaagagctcgcaacctac
ctgctagatgctctgcatgaagacacaaatcttgtaacaaagaagccatatgtggaaaag
ccggagcagaaggacactgaaagtgaccaggaggccgcagataatgcatgggaactgcat
ttgaaacgagaaaatagcaaggttcttgaaaattttatgggacagatcaagagccgagta
caatgctgcaaggcaaactgcaatcgggtatcgaccacctttgacccatttatgtattta
tccgtaccgattccgggatcaatggaacgcatactcaaggttacatatgtccctatgaac
cctcagcagcgtatgcagaagcttgagatcacaatcagcaaaatggcgacgatgaaagag
ctctttggtcttctaaagaccatagacgacctcgcattggaggacacgtgtgctgtggac
atctggcatcaagaggtttacagctggtacgagcctaaaaatgaagtggatcgtatcaga
gataacgattatacgttcttgtacgaattggcgcctctggcaatggtcaaggcgatggga
cagactgtgctaaatggaattgaaactgacgacgatgttggtcttggaacaattacgaag
cattaccagctcgatttggccacaatgactaagttgaatagcggcgatgattggtcagca
aagctgtcgacataccttcagaaccccaccatgttgcataattcgtcgcgcgacaactgc
tctgaattggtgaatacttcgacgaacgaagaggatgtgcttgatatcattgagcgatgc
gaatcctctgctttccttgagaacgtcagatcaaggcatgatttagcaattttggagttt
atagcgtcaaaaatgagaaaagaaattgtcagtcttgagaatcaacaaacaactatgtac
cctgatggagtgataattcaaatccatattcggaaagctaccttgttatctggtaaccat
cgcaccgatgaatgtgtagcaaggaagtcttcgaatgcaacgacagtattggattgtatc
gaaaaatattgccagatggagcagctggaggatactgagatgtggtactgcaacaaatgc
aaagatcatgtccgagcgtggaaacagactcacctctaccgctgtcctccaatattgata
gtgcacttaaaacgctttcagtactcgtcatcaacgcaccgccgagacaaaattgggcta
tttattgatttccctctcgaaggacttgatcttacgagcgttgcacttcattggaccgga
gcagagaaacctctttacgattgctacgccgtaagcaatcactacggggggcttggtggt
ggacactatactgcttatgcattaaatgacgacaaagtttggtgtcattacgatgatagc
cgagtgaccgccaatgtggaacccgaagaagttgtgtcagaagcagcctacgtactgtac
tatcggaga

DBGET integrated database retrieval system