KEGG   Phaeodactylum tricornutum: PHATRDRAFT_9829Help
Entry
PHATRDRAFT_9829   CDS       T01075                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
pti  Phaeodactylum tricornutum
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:pti00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PHATRDRAFT_9829
Translation factors [BR:pti03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PHATRDRAFT_9829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 181 aa AA seqDB search
LNAKWTIWYDNPRLAPEGADWKENLKMCGHFDSVESFWRVYNNLKPASQIGLNSNYSVFR
YGVEPSWEDACNREGGKFVFSIPKKDGKSRIDDFWLHTVLSTIGETMDATGDQVNGVVVS
IRKHQDRVALWLKSSDKAICGQIGVRWKKILNLDSQFLQYQTHKDAAESGRSFRNETYFE
V
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
cttaacgccaaatggaccatatggtatgacaatcctcgtttggctcctgaaggtgccgac
tggaaggaaaacttgaagatgtgcggtcactttgattccgtcgaatctttctggagagtc
tacaacaatctcaagccagcctcccaaattggtctcaattcaaactattccgttttccgg
tatggtgtggaaccaagctgggaagacgcatgcaatcgtgaaggcggaaagttcgtattt
tcaattccaaagaaagatggcaaaagcagaatcgatgacttttggcttcacactgtccta
tcaacaataggagaaacaatggatgccaccggtgatcaagtcaatggtgttgtcgtatca
attcgaaagcaccaagaccgtgtcgcactatggctgaaatctagtgataaggctatttgc
ggtcaaattggagtgcgctggaagaaaattctcaacttagactcgcaattcttgcaatat
caaacacacaaagatgccgccgaaagtggaagatcgtttcggaacgaaacttattttgag
gtatga

  All links  
No link information was found.   
DBGET integrated database retrieval system