KEGG   Phaeodactylum tricornutum: PHATRDRAFT_bd1000Help
Entry
PHATRDRAFT_bd1000 CDS       T01075                                 

Definition
phospholipase
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pti  Phaeodactylum tricornutum
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pti00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:pti04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 889 aa AA seqDB search
MAKTEEELDSGPDEGSLLVLPPDDKKSSLAKTQMMSQRTMKWTQTKTPATSVGKALMEQT
QGYNKAIKGIHVSKITSRGKFRSRILTVSHDRFALFCTHQSIKGGSGFLSTMARKLPVPF
ITRKGVRGFTQPEALRDKYVRYIDIADIDSVQVGVVGTQKLEAAREHNRLKGKDSRVDIH
RNEIVTIVHHGHDSLDVLITKKDERVELVNCIQKMRKAYFEAQRNVSNEALLLRYIWYDV
DVNRDGQIGETEFNKILNRINFSVKNPGKVFREHIKSKLKSRKQDGLSYPEVMELLQKLK
KQKNTSMANLIWDEVFGIEADKVSAGQFLSKFIHAKQGQHNASIANAIEVISSLNQMEIN
HQFGEPLLVMPDDELSRARFELYLFDVMNSACDPWKLQMIGDVTLDQPMSKYWINTSHNT
YLTGDQLQSTSSVEMYMRSLRRGCKCLELDCWDGEKSDSGDYLPIVFHGHTLTSKILFID
IIRGVRSYMAFHKFTYPVILSLENHCSHPFQLAIAKILEDVLGDYLYVPAVDVSQHPLPS
PESLRGRVVIKGKRPPEPDDNAEELAEPVDDEEDPYDPKAIPVAGKADTKISKHAKIVKE
LARLTLFHGTKFKAFEQSITEPFSHMHSIGEAKIGKILSKNPANTDLWRQYNVNHMTRTY
PSGTRVDSSNYNPLLAWSVGSQLVALNFQTSDTPLLLNDGRFRENKHSGYVLKPPSVLGI
ASETLIRTKKQRSRIIPEDNFRKRVLPLCVRVRVLSGSCLPKPRGAKAGEAIDPYVIVTM
HDVLRNEDGKATYVYSSHSTASVNDNGFCPVWNDKKTKDFIVNTPEVAMVHFSLRESDVG
LDEKVGDATIPINMLRPGYRSIQLLDSNNTRTGPFGFATLLVQIHMTDM
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagactgaagaagagcttgactccggtcccgacgaagggagtcttctcgtcctt
cctcccgacgataaaaagtcctcgctagcaaagacccaaatgatgagtcaacgaacgatg
aagtggacacaaaccaagacgccggcgacctcggttgggaaagctctcatggagcaaacg
caaggatacaacaaggctatcaaaggcattcatgtttccaagatcacttcacggggaaag
tttcgctcgcgcattttgaccgttagtcacgatcgcttcgccttgttttgcacccatcaa
tctataaaaggtggatcgggatttctttcaacgatggctcggaagctgcctgtaccattc
ataactcgtaagggtgttcgaggtttcacccagcccgaggcattgcgagacaagtacgtc
cgctacatcgatatcgcagacattgattcggttcaagtgggtgttgtaggaactcagaaa
ttagaagccgccagggaacacaatcgcctgaaaggaaaagattccagggtggatatccat
cgaaacgagattgttacaattgtccaccatggccacgattccttggatgtgctcattacc
aagaaagatgagcgtgtcgaactggttaattgtattcagaagatgcgcaaggcatacttc
gaagcacaaaggaatgtgagcaatgaggctcttctgctgcgctacatttggtatgacgta
gatgtgaatcgggacggacaaatcggtgagacagaattcaacaaaattctaaaccgcatc
aatttttcagtcaagaatccaggcaaggtctttagggaacacatcaagtccaaattgaaa
agccgaaaacaagatggcctttcgtaccccgaggtgatggaacttctccagaagctcaag
aagcaaaagaacacgtcgatggcaaacttaatctgggatgaggtttttggcatagaggct
gataaagtatcggcgggtcagtttctctctaagttcatccacgctaaacagggacaacac
aatgcatcgatcgcgaacgccattgaggttatttcttctttgaatcaaatggaaatcaat
catcaatttggtgaacccttacttgttatgccagacgatgagctgagtcgtgctcgtttc
gaattatatctgttcgatgttatgaatagtgcatgtgatccttggaagcttcagatgatc
ggcgacgtgaccctagatcaacccatgtcaaagtattggatcaacaccagtcacaacacg
tacttgacaggggaccaactgcagagtaccagttctgttgaaatgtatatgcgatcactc
aggcgtggctgcaaatgcctcgagctagactgctgggatggggagaagtctgactcaggg
gattacctgccgattgtctttcacgggcatacattgacatctaagatcctttttatcgac
attattcgaggagttcggagctacatggcctttcacaagttcacctatcctgtaattttg
tcgctcgaaaatcactgctctcatcctttccagctggcgatcgccaaaattctcgaagat
gtcctcggcgactacctatatgttccagcggttgacgtttcgcaacatccattgccatct
ccggagtcattgcgaggtagggttgttataaagggcaagcggccgcctgaacctgacgat
aatgccgaagaattggcggaaccagtcgacgatgaagaagacccctatgatccgaaggcg
ataccggtggccggaaaagctgacaccaagatttccaaacatgccaaaattgttaaggag
cttgctcgattgaccctcttccatggaactaagtttaaagctttcgagcaatccattacc
gaaccgttttctcatatgcattccattggtgaggccaaaatcggaaaaattctgagcaag
aatcctgcaaacacagatctttggcgtcagtacaatgtaaatcacatgacgcgcacttat
ccgtcagggacgcgggtcgactcttccaattataatcctcttttggcgtggtcggtgggt
tcgcaacttgtggcactgaactttcagacgagtgacacacctttgcttttgaacgatgga
cgttttcgtgaaaacaaacactctggatacgtcctcaagccaccgagcgtcctgggaatt
gcatcagagaccttgatccgtaccaaaaagcagcgctcccgaattatcccagaagacaat
tttcgaaagagagttcttcctctgtgtgtcagggtccgtgtattatcaggcagctgcttg
cccaaaccaagaggagccaaagcaggggaagcgatcgatccctacgtgattgtaacgatg
cacgatgttctaaggaatgaagatggtaaagccacatatgtgtatagctctcattcgaca
gcttccgtaaacgataacggattttgcccagtgtggaacgataaaaagacgaaggacttt
atcgttaacaccccggaagtcgcgatggtacacttttctttgcgcgagagcgacgttggg
ttggacgagaaggtaggagacgcaacaattccgatcaacatgctgcgaccaggctacaga
tcaatccagcttctagactccaataacacgagaacgggaccgtttggttttgcaactcta
ttggtccagattcatatgacagacatgtaa

DBGET integrated database retrieval system