KEGG   Phaeodactylum tricornutum: PHATRDRAFT_bd1023Help
Entry
PHATRDRAFT_bd1023 CDS       T01075                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PHATRDRAFT_bd1023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 266 aa AA seqDB search
MEKRGDGTSLYGTFIRLSWHASGTYSKADNSGGSNGGRMRFTPEAGWGANAGLKVARDAL
EPVKAKFPGLSYADLYTYAGVVAVEEAGGPIIPFATGRTDESDGKASPPDGRLPDADKGA
RIATITHVRDIFYRMGFNDQEIVALLGAHAMGRCHTDRSGYWGPWSNAENTFSNEYYRLL
VEERWSPKVTHNGKPWTGPDQYEDASGQLMMLPSDIAMIADPEFKKWVELYAKDEDRFFN
DFSKAFAKLLSLGVPFAATKPWYQFW
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcgcggtgacggcacctcgctctacggtacttttatccgtctctcctggcat
gcctcgggtacctacagtaaagccgacaattcgggcggttcgaacggtgggcgtatgcgt
tttacccccgaagccggatggggcgccaacgccgggctcaaagtagcccgcgacgccctg
gaacccgtcaaggccaagttccccggtctatcgtacgccgacctctacacctacgctggt
gtcgtcgcggtggaagaagccggaggccctatcattccctttgccacgggccgcacggac
gaatcggacggcaaggcctccccgccagacggccgtctccctgacgccgacaagggagcc
cgcatcgccaccattactcacgtgcgcgatattttctaccgcatgggctttaacgatcaa
gaaatcgtcgctctcttgggtgcgcacgccatggggcgctgccacacggatcgcagtggc
tactggggaccctggtctaacgccgaaaacacctttagcaacgaatattatcgactcttg
gtggaagaacgctggtcgcccaaggttacgcacaacggcaaaccctggacgggcccggat
cagtacgaggatgcctccggtcagctcatgatgctaccctcggatattgccatgatcgcc
gacccggaattcaaaaagtgggtggaactctacgccaaagatgaggatcgcttcttcaac
gactttagcaaggcgttcgctaaactattgtccctgggcgtgccctttgccgccaccaag
ccgtggtaccagttttggtaa

DBGET integrated database retrieval system