KEGG   Phaeodactylum tricornutum: PHATR_10378Help
Entry
PHATR_10378       CDS       T01075                                 

Definition
hypothetical protein
Orthology
K00654  
serine palmitoyltransferase [EC:2.3.1.50]
Organism
pti  Phaeodactylum tricornutum
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pti00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 486 aa AA seqDB search
MSTFIACTTYLAYATFIFVGHVRDFFAWFLGRGRFVRVASDFPGDDWSRFAPLLKSWEDF
YFRRIYIRVQDAFNRPIASKPGSHIDVLERVSDDAQKSMHAPDGSVCRQCLNLGSYNYLG
FADDWHVTCARDVMASLQDFSVSTSSARNEYGTTALHRQVETTVARFLGKEDAICLNMGF
NTNATTIPSLVGRGDLLISDELNHTSIVNGARASGAAIRVFKHNSIIDLEATLKQAIILG
RPRTRRPWNKILVIVEGIYSMEGEYCDLRGVVDVCKKYGAYIYLDEAHSIGATGATGRGC
TEFAGVDTADVDILMGTFTKSFGAMGGYVAADRATIQHLRNTCAASSCHNALSPVVCQQV
LTAFKVIMGEDGTNIGKQKLQSLRDNSNYFRMRLEEMGLQVLGQYDSPVMPIMLYNPCKI
AAFSRECYKRGLAVVVVGFPAVPLLLSRARFCISAGHAREDLDRALAEIDEIAEVLKLRY
ARSFCG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccttcatcgcctgcaccacctacttggcctacgcgacctttatctttgtcggg
cacgtccgtgacttctttgcctggttcctgggacgcggtcgttttgtgcgggtcgcttcc
gatttccccggggacgactggtcgcgctttgcgccgctcctcaagtcttgggaagacttt
tacttccgccggatctacatccgcgtgcaagacgcctttaatcgtcccattgcctccaaa
ccgggatcgcacattgacgtactcgaacgtgtctcggacgacgcccaaaagtctatgcac
gcgcccgacggtagcgtttgtcggcagtgcctaaacctgggctcttacaattatttgggc
tttgccgatgattggcatgtgacctgtgcacgggacgtcatggcttcgcttcaagacttt
agcgtctccaccagtagtgcccggaacgaatacggcactaccgccctgcatcgccaagtc
gaaaccaccgtggcacgatttttgggaaaggaagacgccatttgcctcaatatgggtttc
aataccaacgccactactattccttcgttggttgggcgcggagatttgctcatttccgat
gaactcaatcacaccagtatcgtcaacggcgcgcgtgcctcgggtgccgccattcgagtt
ttcaagcacaacagtattatcgatctggaggcaacgctcaagcaagcgataattttgggg
cgtccccggactcgccggccctggaacaagattctcgttattgtggaaggtatttacagt
atggaaggcgaatattgcgacttgcgcggtgtcgtggacgtgtgcaagaaatacggtgcc
tacatttatttagatgaagctcattcgatcggagcgacgggtgccaccggacgaggctgc
accgagttcgccggggtagacacggccgatgtggatatccttatgggtacctttaccaag
tccttcggggcgatgggtggatacgtggccgccgaccgcgccaccattcaacatttgcgc
aacacgtgcgctgccagttcatgccacaacgccctatctcccgtggtgtgtcagcaagtc
ctcacggcattcaaggttataatgggcgaagacggcaccaatattggcaaacaaaaactt
caatcgctacgcgacaattccaactatttccgtatgcgcctcgaagaaatgggtctccaa
gtgctcggtcagtatgattcccccgtcatgccgattatgctttacaacccctgtaagatt
gccgccttttcccgggaatgctacaaacggggcttggccgttgttgtcgtgggcttccct
gccgttcctttgctgctctcccgggctcgcttttgcatttcagccggacacgcgcgtgag
gatttggatcgcgccttggcggagattgacgaaattgctgaagtcctaaaattgcgatac
gcccgttccttttgtggctaa

DBGET integrated database retrieval system