KEGG   Phaeodactylum tricornutum: PHATR_10378Help
Entry
PHATR_10378       CDS       T01075                                 

Definition
hypothetical protein
Orthology
K00654  
serine palmitoyltransferase [EC:2.3.1.50]
Organism
pti  Phaeodactylum tricornutum
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PHATR_10378
Enzymes [BR:pti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     PHATR_10378
Amino acid related enzymes [BR:pti01007]
 Aminotransferase (transaminase)
  Class II
   PHATR_10378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 486 aa AA seqDB search
MSTFIACTTYLAYATFIFVGHVRDFFAWFLGRGRFVRVASDFPGDDWSRFAPLLKSWEDF
YFRRIYIRVQDAFNRPIASKPGSHIDVLERVSDDAQKSMHAPDGSVCRQCLNLGSYNYLG
FADDWHVTCARDVMASLQDFSVSTSSARNEYGTTALHRQVETTVARFLGKEDAICLNMGF
NTNATTIPSLVGRGDLLISDELNHTSIVNGARASGAAIRVFKHNSIIDLEATLKQAIILG
RPRTRRPWNKILVIVEGIYSMEGEYCDLRGVVDVCKKYGAYIYLDEAHSIGATGATGRGC
TEFAGVDTADVDILMGTFTKSFGAMGGYVAADRATIQHLRNTCAASSCHNALSPVVCQQV
LTAFKVIMGEDGTNIGKQKLQSLRDNSNYFRMRLEEMGLQVLGQYDSPVMPIMLYNPCKI
AAFSRECYKRGLAVVVVGFPAVPLLLSRARFCISAGHAREDLDRALAEIDEIAEVLKLRY
ARSFCG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccttcatcgcctgcaccacctacttggcctacgcgacctttatctttgtcggg
cacgtccgtgacttctttgcctggttcctgggacgcggtcgttttgtgcgggtcgcttcc
gatttccccggggacgactggtcgcgctttgcgccgctcctcaagtcttgggaagacttt
tacttccgccggatctacatccgcgtgcaagacgcctttaatcgtcccattgcctccaaa
ccgggatcgcacattgacgtactcgaacgtgtctcggacgacgcccaaaagtctatgcac
gcgcccgacggtagcgtttgtcggcagtgcctaaacctgggctcttacaattatttgggc
tttgccgatgattggcatgtgacctgtgcacgggacgtcatggcttcgcttcaagacttt
agcgtctccaccagtagtgcccggaacgaatacggcactaccgccctgcatcgccaagtc
gaaaccaccgtggcacgatttttgggaaaggaagacgccatttgcctcaatatgggtttc
aataccaacgccactactattccttcgttggttgggcgcggagatttgctcatttccgat
gaactcaatcacaccagtatcgtcaacggcgcgcgtgcctcgggtgccgccattcgagtt
ttcaagcacaacagtattatcgatctggaggcaacgctcaagcaagcgataattttgggg
cgtccccggactcgccggccctggaacaagattctcgttattgtggaaggtatttacagt
atggaaggcgaatattgcgacttgcgcggtgtcgtggacgtgtgcaagaaatacggtgcc
tacatttatttagatgaagctcattcgatcggagcgacgggtgccaccggacgaggctgc
accgagttcgccggggtagacacggccgatgtggatatccttatgggtacctttaccaag
tccttcggggcgatgggtggatacgtggccgccgaccgcgccaccattcaacatttgcgc
aacacgtgcgctgccagttcatgccacaacgccctatctcccgtggtgtgtcagcaagtc
ctcacggcattcaaggttataatgggcgaagacggcaccaatattggcaaacaaaaactt
caatcgctacgcgacaattccaactatttccgtatgcgcctcgaagaaatgggtctccaa
gtgctcggtcagtatgattcccccgtcatgccgattatgctttacaacccctgtaagatt
gccgccttttcccgggaatgctacaaacggggcttggccgttgttgtcgtgggcttccct
gccgttcctttgctgctctcccgggctcgcttttgcatttcagccggacacgcgcgtgag
gatttggatcgcgccttggcggagattgacgaaattgctgaagtcctaaaattgcgatac
gcccgttccttttgtggctaa

DBGET integrated database retrieval system