KEGG   Phaeodactylum tricornutum: PHATR_10454Help
Entry
PHATR_10454       CDS       T01075                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
pti  Phaeodactylum tricornutum
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PHATR_10454
  Lipid metabolism
   00062 Fatty acid elongation
    PHATR_10454
Enzymes [BR:pti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     PHATR_10454
Lipid biosynthesis proteins [BR:pti01004]
 Fatty acid synthase
  Component type
   PHATR_10454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 298 aa AA seqDB search
SENKQLPVVFAHGMGDSCFNSGMQHVAQLASEWLSEDFGPDRSNVYSVCVPTGATQAEDT
KNGYFLSMDASVEVFAEGVRADPRLSDGFHAIGFSQGNNVIRGYIAKHNTPTVDTFISIN
GVNAGIGAVPYCRPSETAMGAVRLGGMCDLLMEQASRSAYTEFAQEHSFQANYWRDPRPT
AFPLYQKYGQLAAWNNEAGLVNETLKTNWGKTSAFVWVLATEDGLVWPKEGEQWGQPDSK
DPFHVILSINETTWYKEDLFGLRTANELGKNYFESFEGDHLQFESADLERWVKTYLKN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
tctgaaaacaagcaattgccggtggtctttgcccatgggatgggagattcgtgctttaat
tctggcatgcaacacgttgcgcagctggcctccgaatggctcagtgaggactttggtccg
gacagatcgaatgtgtatagcgtatgcgttccgaccggtgcgactcaagcagaagatacc
aagaacggttactttctgagcatggatgcttcggtggaagtctttgcggaaggtgttagg
gcggacccacgactgagcgatggctttcacgccattgggttttcgcagggcaacaacgtc
attcggggctacattgccaaacataacacgcctaccgttgacacatttatatccatcaat
ggggtgaacgcagggatcggtgctgtgccgtattgtcgtcctagtgaaactgccatgggt
gctgtgcgactgggtggaatgtgcgatttactcatggaacaggcctcgcggagtgcctac
actgaatttgcacaagagcattcctttcaagccaactactggcgcgatccacggccaact
gcctttccgctctaccaaaagtacggacagctcgctgcttggaataacgaagcgggacta
gtgaacgaaactctgaaaacgaactggggtaagacctccgctttcgtgtgggtgttggcc
accgaagatggattggtgtggcccaaagaaggagagcaatgggggcagccggattcgaaa
gatccttttcatgtgatcttatccataaacgaaacgacctggtacaaagaggacttgttt
ggcctccgaactgcaaatgaattgggaaagaattatttcgaatcgttcgagggggaccat
ttgcagtttgaatctgccgatctggaacgatgggtaaagacctacctcaagaactag

DBGET integrated database retrieval system