KEGG   Phaeodactylum tricornutum: PHATR_10454Help
Entry
PHATR_10454       CDS       T01075                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
pti  Phaeodactylum tricornutum
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pti01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:pti00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 298 aa AA seqDB search
SENKQLPVVFAHGMGDSCFNSGMQHVAQLASEWLSEDFGPDRSNVYSVCVPTGATQAEDT
KNGYFLSMDASVEVFAEGVRADPRLSDGFHAIGFSQGNNVIRGYIAKHNTPTVDTFISIN
GVNAGIGAVPYCRPSETAMGAVRLGGMCDLLMEQASRSAYTEFAQEHSFQANYWRDPRPT
AFPLYQKYGQLAAWNNEAGLVNETLKTNWGKTSAFVWVLATEDGLVWPKEGEQWGQPDSK
DPFHVILSINETTWYKEDLFGLRTANELGKNYFESFEGDHLQFESADLERWVKTYLKN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
tctgaaaacaagcaattgccggtggtctttgcccatgggatgggagattcgtgctttaat
tctggcatgcaacacgttgcgcagctggcctccgaatggctcagtgaggactttggtccg
gacagatcgaatgtgtatagcgtatgcgttccgaccggtgcgactcaagcagaagatacc
aagaacggttactttctgagcatggatgcttcggtggaagtctttgcggaaggtgttagg
gcggacccacgactgagcgatggctttcacgccattgggttttcgcagggcaacaacgtc
attcggggctacattgccaaacataacacgcctaccgttgacacatttatatccatcaat
ggggtgaacgcagggatcggtgctgtgccgtattgtcgtcctagtgaaactgccatgggt
gctgtgcgactgggtggaatgtgcgatttactcatggaacaggcctcgcggagtgcctac
actgaatttgcacaagagcattcctttcaagccaactactggcgcgatccacggccaact
gcctttccgctctaccaaaagtacggacagctcgctgcttggaataacgaagcgggacta
gtgaacgaaactctgaaaacgaactggggtaagacctccgctttcgtgtgggtgttggcc
accgaagatggattggtgtggcccaaagaaggagagcaatgggggcagccggattcgaaa
gatccttttcatgtgatcttatccataaacgaaacgacctggtacaaagaggacttgttt
ggcctccgaactgcaaatgaattgggaaagaattatttcgaatcgttcgagggggaccat
ttgcagtttgaatctgccgatctggaacgatgggtaaagacctacctcaagaactag

DBGET integrated database retrieval system