KEGG   Phaeodactylum tricornutum: PHATR_10546Help
Entry
PHATR_10546       CDS       T01075                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pti  Phaeodactylum tricornutum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PHATR_10546
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PHATR_10546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 302 aa AA seqDB search
MPGDRNHVVVVGSANQDLTSYTPTVPVMGETVMGQEFETSCGGKGSNQAVAAGSLGISPV
TMICRVGDDVFGEALLDKLASVNVAWDETRTILRGKNSPASGTATIVVDTNSGDNMIIVT
PGANYALSPNDVEESLRALPEPPAIVVVQLEIKPAAALQALRTAKDLGAITVLNPAPAPE
GYTLDDFFPYVDILIPNETELRKCLGKDELSDEDEEALAKELLDKGMGMGVIVTLGARGA
MVTLVDAPRDLPARNEPIKDTIGAGDAFCGALSTYLSAGLSLTEAAGKACGVASMSVRRR
GA
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgccgggagatcgcaatcatgtcgtggtggtcggatccgccaaccaagatttgacatcc
tacactcccactgtgccagtcatgggcgagaccgttatgggtcaagaattcgaaacctcg
tgtggaggaaaaggttccaaccaagccgtcgcggcgggcagtctcggaattagtcctgtt
accatgatctgtcgcgtaggggacgatgtatttggcgaagcgctcctcgacaaattggct
agcgtaaacgttgcctgggacgaaactcgtaccattttgagaggcaaaaatagtcctgcc
tcgggaacggctactattgtggtcgataccaacagtggggacaatatgattatcgtgaca
ccaggtgctaactatgcgctttctccgaacgacgtggaagagtcgctgcgagcccttccc
gaaccgcctgccattgttgtagtgcagttggagatcaagcctgctgccgcattacaggcg
ctccgcactgcaaaagatttgggcgccattacggttttaaacccggcacccgccccggaa
ggctacacgctggatgattttttcccgtatgtagatattctgattcccaacgagaccgaa
ttgagaaaatgtctcgggaaagatgaattgtccgacgaagacgaagaagcgctagccaaa
gaattgctcgacaaagggatgggtatgggagtcattgtaactctaggcgctcggggagcc
atggttactttagtggacgctccaagagatctgccagcgcgcaacgaacctattaaagac
acaattggagcaggcgatgccttttgcggtgcactgtcgacttatctttcggccggttta
tccctgacggaggctgctggcaaggcatgcggtgtggctagcatgtcggtgcggcgtcgt
ggcgcc

DBGET integrated database retrieval system