KEGG   Phaeodactylum tricornutum: PHATR_13244Help
Entry
PHATR_13244       CDS       T01075                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PHATR_13244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11
AA seq 253 aa AA seqDB search
PTFVRLAWHSSGTYDQITRTGGSGEGTIRFKEELAHGGNAGLADTAVVWLEPLYKKYKKD
GLSYADLYTLSGVASIKQMNGPTIPWGSGRVDAMSPIVVTPDGRLPNADVGPKGADKSDA
AHLRDVFYRMGFNDQEIVCLSGAHALGRCHTTASGYDGPWTPTPTTFNNAYYTLLSNLNW
VPKEWDGPYQYVDAPTGRLMMLPTDLVLLQDKSFAKYVKEYASNPKKFDYDFTVAFQKLE
ELGTNNLTPCDWA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
cccacgtttgtgcggttggcatggcattcgtcgggaacgtacgaccaaattaccagaacg
ggaggatcaggggaaggaacgatccgcttcaaagaagaactcgcgcatggtggcaacgct
ggtctcgccgatacagccgtcgtatggctggaacctttgtataaaaagtacaagaaggac
gggttatcctacgcagacctctacactctttcgggagtagcttcaatcaagcaaatgaat
ggccccactattccatggggctcgggacgggtggacgccatgagtccgattgtggtcact
ccagacggacgattgccgaacgccgatgtcggacccaagggggctgacaagagtgatgcc
gcccatttgcgcgatgtcttttatcgtatgggtttcaacgaccaagagattgtttgcctt
tctggagcgcacgctttgggccgctgtcacacaacagcatcggggtatgatggtccttgg
actccaactccaactaccttcaacaatgcgtattatactttgctttccaatctcaattgg
gtgcccaaggagtgggacggtccttaccaatacgtggatgctcccaccggtcgcctcatg
atgcttccgacagacctggtattgctgcaagacaaatccttcgccaagtatgtaaaggag
tatgcgagtaatccaaagaaatttgattacgatttcaccgtggcatttcaaaagctcgaa
gagctgggcaccaacaacttgactccgtgtgattgggcgtag

DBGET integrated database retrieval system