KEGG   Phaeodactylum tricornutum: PHATR_13265Help
Entry
PHATR_13265       CDS       T01075                                 

Gene name
CHLH
Definition
protoporphyrin IX magnesium chelatase, subunit H
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PHATR_13265 (CHLH)
Enzymes [BR:pti01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PHATR_13265 (CHLH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11
AA seq 1343 aa AA seqDB search
MGGGMFTRSNSESRRVVPEDPRGRPTMKVVYVVLESQYQSSMTAAVKRINAGSDNMAVEC
VGYLLEELRNEDAFEQFKKDVADANIFIGSLIFVQELAEKVVEVVEPQRERLDACLVFPS
MPEVMRLNKVGTFTMKNLGQSKSVVADFMKKKKQEDGSSFEEGMLKLLRTLPKVLKFLPS
DKAADARTFMMSFQYWLGGSPENLESLLIQIGQDYVAPIQESMKGKDKVKAEDPVLLPDK
AIWHPVAPDIVFENNQKYFEWYNNEFCPDAGIDPKTAPTIGIILQKSHINTKDDTHYVSL
ISELESRGARVVSIYSGGLDFSGPVEEYFYDSNGKPIVDTVINLTGFALVGGPASQDHAK
ASQVLKKLNRPYMCAVPLVFQSFEEWQSSELGLHPIQVALQVSLPEIDGAIEPIIFAGRE
GATGRSVPLADRVNLLADRSLKWANLRSKPKSEKKIAITIFSFPPDKGNVGTAAYLDVFD
SIKAVLGQLKSEGYDVGDAPMNKEAIMASVLDDPEAKISSPELNVAYRMSTEEYYELTPY
ATDLEENWGPAPGNLNSDGQNLVVYGKQFGNVFIGVQPSFGYEGDPMRLLFAKSASPHHG
FAAYYTYLEKIFQADAVLHFGTHGSLEFMPGKQVGMSGTCYPDRLINSLPSAYLYAANNP
SEATIAKRRSYSATVSYLTPPAENAGLYKGLKELKELIASFQGLRGNEGRGAAIVNSIVS
TAWTCNLDKDIDLPSLETYDAAKDTAENRDSIVGQVYSQIMQIESRLLPCGLHTVGVPPT
AEEAIATLVNIGQLDRPEDKIEGLPRVIASSVGREINEVYRGNNQGVLTDVELNEKIVMA
SRAAVRALVMQSTGSDGRVKEVKSAFDEMSAMFGKMMGQKKPWTKAIIDAGFPDVNEARL
DPVITYLEFCLKQVVANNELGGIMELLNGEFLMPAPGGDPIRNPAVLPTGRNMHALDPSS
IPTAAAVEVSQDVVRKLLEKLRDENDGAFPESIAFTLWGTDNIKTYGESLAQVLALVGVR
PVADSLGRVNKVELIPLEVLGRPRIDVVVSCSGVFRDLFINQMNLMDRGIKMAAEADEPL
EMNFVRKHAMEQAEELGVSLRDAAARVFSNSAGSYSANVGLAIENGGWEDEGQLQEQFLT
RKGFAFNADKPGMMEQQAALFKSALKTVDVTFQNLDSSEISITDVSHYYDSDPTKVVQGL
RDDKKKPMSLMADTTTANAQVRTLSETVRLDARTKLLNPKFYEGMLSTGYEGVREIQKRL
RNTMGWSATAGEVDNFVFEDANSVFIEDAEMQKRLLDTNPNAFRDMVTTFLEANGRGYWD
TSDENIERLQELYAEVEDRIEGV
NT seq 4032 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtggtatgtttaccaggagcaattcggaatctcgtcgggtcgttccggaagac
cctcgtggaagacccaccatgaaggtcgtttatgtggtgctcgaatcgcagtaccaatct
tccatgacggctgccgtcaagcgaatcaacgcgggatcggacaatatggccgtcgaatgt
gttggttacttgctagaggaactccgcaacgaagacgcctttgagcagttcaaaaaggat
gtggccgacgccaatattttcatcggctccctcatttttgtgcaggagctcgccgaaaag
gtcgtcgaggtagtagaaccccaacgggaacgtctcgatgcctgtctcgttttcccttcc
atgccggaagtcatgcgtcttaataaggtgggaaccttcactatgaaaaacttgggacag
tccaagagtgtcgtggctgatttcatgaagaagaagaagcaggaagatggttccagtttt
gaggaaggaatgttgaagctcctgcgtacccttcccaaggttttgaaatttcttcccagt
gacaaggccgcggacgcgcgtacctttatgatgagtttccagtactggctcgggggatcc
ccagaaaatctcgaatctctcctgatccaaatcggacaggattacgtcgcccccatccaa
gaatctatgaagggaaaagacaaggtcaaagcggaggaccccgtcttgctacctgacaag
gccatttggcacccggttgctcccgatattgtgtttgaaaacaatcaaaagtactttgaa
tggtacaacaacgaattctgccccgacgccggtatcgaccccaaaacggccccaacgatt
ggtattatcctccaaaagtcccacattaacaccaaggacgacacacactacgtttcgctc
atttccgagctcgaaagccgtggcgcccgtgtcgtttccatctattcgggaggtttggat
ttttccggacctgtcgaggaatacttttatgattccaatggcaagccgattgtggacact
gtcattaacttgactgggttcgccctcgtcggaggaccggcttcgcaggatcacgccaag
gcttcacaggttctcaaaaagttgaatcgtccgtacatgtgcgctgtgcccctagtcttc
cagtcgttcgaggaatggcagtcatccgaactcggactccatccgattcaggttgctctg
caagtgtctttgcccgaaattgatggagctatcgaacccattattttcgctggtcgcgaa
ggtgctacgggacgtagtgttccgctcgccgatcgtgtcaaccttttggccgatcggtct
ctgaagtgggccaacctccgctccaagccaaagtctgaaaagaagattgccataaccatc
ttctcctttcctccggacaagggcaatgttggaactgccgcctacctggatgtttttgat
tccatcaaggctgttttgggacagctcaaatcggaaggatacgacgtaggtgacgctccc
atgaacaaggaagccatcatggcttccgtcctggacgatcccgaagcaaaaatttcttca
cccgagctcaatgttgcgtaccgcatgagcaccgaagaatattacgagttgaccccgtac
gcgacggatttggaggaaaactggggaccggcacctggtaacctcaactcggacggtcaa
aacctggtagtgtacggaaagcagtttggcaacgtctttatcggtgtccagccttccttt
ggatatgagggcgacccgatgcgattgcttttcgccaaatccgcgagcccccatcacggc
ttcgccgcatactatacgtacttggagaaaatcttccaagccgacgctgttttgcatttc
ggaacgcacggatctttggaattcatgccaggcaagcaggtaggtatgtccggcacctgc
taccccgatcgtctgattaactcgctgccatccgcctacttgtacgctgccaacaacccg
tcagaagccacgattgccaaacgtcgctcgtactctgctacagtctcgtacctgacgccg
ccggcggagaacgccggtctctacaagggactgaaggaactaaaagagctcatcgcctct
ttccagggtctacgcggaaacgaaggacgcggcgccgctattgtcaactctattgtctca
accgcctggacctgcaacttggataaggacattgatcttcccagtctcgaaacgtacgat
gccgccaaggacactgccgaaaaccgtgacagtattgtgggacaagtttattctcagatt
atgcagatcgaaagccgtctcctcccttgtggcctgcacactgttggggtgccaccgacc
gctgaagaagccatcgcgaccttggttaacattggtcagctcgatcgaccggaagacaaa
attgaaggacttcctcgggtgattgcctcatcggttggtcgtgagatcaacgaagtctac
cgtgggaacaaccaaggtgtcctaacggatgtcgagctaaacgagaagatcgttatggct
tcccgtgctgctgtccgcgccttggttatgcaatcaaccggctctgacggacgtgtcaag
gaagtcaaatccgcctttgacgaaatgagtgccatgtttggaaagatgatgggtcagaaa
aagccctggacaaaagcaattattgatgccggtttccccgatgtgaacgaggctcgcctt
gaccctgttatcacatatcttgagttctgcctcaagcaagttgtggcaaacaatgaactc
ggaggaataatggagcttttgaacggagagtttttgatgcccgcccctggtggcgaccct
atccgcaaccctgcagtcctacctactggacgcaatatgcatgcacttgatccatcctct
attcccacagcagctgctgtagaagtttcgcaggacgttgttcgaaaacttctcgaaaag
cttcgggacgagaacgatggtgccttccccgaaagtattgcctttactttgtggggtacc
gacaacatcaagacctatggggaatcgctcgcgcaggtgctcgctctagtcggtgtccgc
ccggttgctgattctcttggacgcgtcaacaaggtcgaacttattcctttggaagtcctt
ggacgtccccgtatcgacgttgtcgtttcatgctccggtgtcttccgtgatcttttcatc
aaccaaatgaatttgatggatcgtggaatcaaaatggctgccgaagctgatgaaccttta
gaaatgaactttgtccggaaacacgcgatggagcaagccgaagaactcggagtctcactc
cgtgacgccgccgctcgcgtcttctcgaactctgccggatcatacagtgctaacgtaggc
ctcgccattgagaatggtggatgggaagatgaaggccagcttcaggagcagttcttgacg
cgcaagggctttgcgtttaacgccgataagcctggtatgatggaacagcaggctgctctt
ttcaagagcgctttgaagactgttgacgttacctttcaaaacttggactcgtctgaaatt
tcgattaccgatgtttcgcactactacgattctgatcctactaaggttgtccaaggtctc
cgtgacgataaaaagaaacccatgtcgcttatggctgataccaccaccgccaacgctcaa
gtccgtacattgtccgaaaccgttcgactcgacgcccgtactaagctattgaatccgaaa
ttctacgaaggtatgctttcgacaggatatgaaggtgtccgtgaaatccagaagcgtctc
cgcaatactatgggatggtccgcgaccgccggcgaagtcgataactttgtatttgaggac
gccaacagcgtgtttattgaggatgccgagatgcaaaagcgtcttctcgacacgaatccc
aacgctttcagagatatggtgaccacattcttggaagcgaatggtcgcggatactgggac
acgtcggatgagaatattgagcgtcttcaggagctgtatgcggaggtggaagaccgcatc
gaaggtgtataa

DBGET integrated database retrieval system