KEGG   Phaeodactylum tricornutum: PHATR_18549Help
Entry
PHATR_18549       CDS       T01075                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
pti  Phaeodactylum tricornutum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 1250 aa AA seqDB search
MDPPDVVDKPHPCAVLHTWIDPNAERAATAREKIGERLEQQYSKWQTASTAWPLRKRRTV
DPTMEDVRSLCQHLRRHARNERVLFHYHGHGVPRPTHNGEIWAFDAKRTEYIALSVADVR
TWLGKPSIVVLDCSSAGVLVPFFTAPMADPSVAPSSTPSRAQTEPTNLREQASEWVSDTV
VLCPCSEGEWLPMNPDYPVDIFTSCLTTPLKIALRWFIQRNPVSMASLHPDAVDHIPGVF
NDRKTPLGELNWIFAAVTDSIAWNVLPKPLFQRLFRHDLLMSSMFRNFLLADRVLRSMGC
TPVSYPPLPPGISNHQLWQSWDLACETMLVQLMNDGTSRHPTNHTVSVSSPFFSEQLTAF
EVWLEFTSIHKMQLKLGMLEPPEPLPMVLQVLLSQTHRIRALHLLRRFLEFGPWAVNLSL
ILGIFPYVSKLLQSPDYKSLLVGIWASILAFDPSCRVDMLKNGILHHFVQYLTLDPDAYG
SVKEAKAARERTLAAFDLSITCCGYPMGQSECVRLRLHNHFCALFSAYEKTEKCQYDDME
LYLPARFRLWLCICIANMMKDNNATQAEAYNAGVHSRLFVRMSDQDPDVRAAVCYALGCL
LGTSAKNEQTGKNLLTIEVLLKAVEDASVVVRYEATLGLARAVGKYLDAFVSVASTAASN
EDRNMYVSLPPAVDLKTGDRFALVWSILRLLQHNDPFPFIAKAANDIVCVVFEHLLRRRL
TTSDRDDKGRQSLALRAEKLASNLTGIEEEQDSDGIAGHSIDSTPPLSEAPTQQPSAVMQ
KSPQADLRRVASESITGRNTAHSMEQNALDMNLSGVLKEDMVKGGPVHYILPKSQFFEWK
RDSFDINFEFVDDDTPADTDPLKMLYEQESEDALLAVEEEATLKKGELELQENMLLRNEG
VKMTSMVRFHAYEDVLMACGASDAVSMWCTNSGKQLTKFLNSKTKKARLTTSAWINEHAS
SLFMVGGDTGNVHVWGNLLESNGEACRTPAKLISAFQAAPMTAGQRGSGLICEWQSYSGT
LLAGGSSKTLRCWDLESEKLSNQFETNTDANLTTLTTAWDYDELGMGPGPKGYQGIGQDI
VVGGFSDGALRIFDIRTNQAGSSLQSSQPTRPRRKRATEFSEHKTWVVSTSFTAYGNRYE
LISGTISGEIKIWDLRMSSSIRTFAAQRSTMTSFAVHSKIPILATGSHAQFIKLLTLDGD
AFQVMRYHGKMASHRIGPVSCLAFHRFKPMLAAGATDAYIGLYTTKKRFI
NT seq 3753 nt NT seq  +upstreamnt  +downstreamnt
atggatcctccagatgttgtggataaacctcatccctgtgcagtgcttcatacttggatc
gaccccaacgccgaacgtgcggccacggcacgcgaaaaaatcggagaacgccttgagcaa
cagtattccaagtggcagacagccagcacggcctggccgttgcgcaaacgacggacggta
gatccgaccatggaagatgtacggagcctttgccagcatctccgtcgacacgcccggaac
gagagagtcttgtttcattaccacggacatggtgtgccgagaccaacccacaacggagaa
atatgggcgttcgacgccaagcgtacagaatacattgccttatcggttgcagatgttcgc
acgtggctgggaaaacccagtattgttgttttggactgttcctccgctggcgtgctagtg
cctttctttacggcgccaatggccgatccttcggttgcaccctcctcgacaccatcgcga
gctcagaccgaaccgacaaatctcagggaacaagcatcggagtgggttagcgacacagtc
gtactatgtccttgctctgaaggcgaatggctacccatgaacccagactatcccgtcgac
atttttacgtcgtgtttaaccactccactcaagattgctcttcggtggttcattcaaagg
aaccccgtcagcatggcttcccttcaccccgatgcagtagatcacattcctggtgttttc
aacgatcgaaaaactccactcggagaattgaattggatatttgccgccgtaacggactca
attgcttggaacgtactgcccaaaccgctatttcagcgactttttcgtcacgacttgctg
atgtccagtatgtttcgtaactttttattggctgaccgagttctgcgatcgatgggttgc
accccggtatcctatcctccgttgccaccgggcatttcgaatcatcaactgtggcaatct
tgggacttggcctgtgaaacaatgttggtgcagctcatgaatgacggaacttccaggcac
cccaccaatcacacagtgagtgtctcatcaccgtttttctcagagcaattgacagctttt
gaagtatggctagaatttacgtcaatccataagatgcagttgaaactcggaatgctggag
ccacccgaaccgctgccaatggtactacaggtcctacttagtcagacacaccgtattcgt
gcgttgcacctccttcggcggtttttagaatttggcccatgggcagttaacctgtcactc
attctgggaatttttccctacgtgtcgaaattgctgcaatctcctgactacaagagctta
ttggttggtatttgggcatctatcttggctttcgacccttcttgtcgcgttgacatgctg
aaaaacggaattcttcaccactttgtccagtatttgacattggacccggatgcatatggt
tcagttaaagaagccaaagccgctcgggagcgaaccttggctgcgttcgacttgtccatt
acttgctgtggttaccctatggggcagtccgaatgtgttcgacttcgcctccataatcat
ttctgcgcgctcttttctgcttacgaaaaaacagaaaaatgtcagtatgacgatatggaa
ctttatttgccagcgcgctttcgactttggttatgtatttgcatcgcgaatatgatgaaa
gacaacaatgcaacgcaggctgaagcgtacaacgctggtgtacattcacgcctatttgtg
cgaatgagtgaccaagatccggacgtgcgagccgcagtttgctatgctcttggttgcctc
ctcggtacttccgcgaaaaatgaacaaacagggaaaaatttgttaacgattgaggtctta
ttgaaagcagttgaagacgcgagtgttgtagtacggtacgaagctacactcggtctagca
cgagcagttggaaaatatcttgatgcctttgtatccgttgcctccaccgcagcaagcaat
gaagatagaaatatgtatgtttctttgcctcctgccgttgatctcaaaacaggcgatcgt
tttgcactggtttggagcatcttgcggttattgcagcacaatgacccctttcctttcatt
gctaaggcggcaaacgatatcgtgtgcgtagtctttgagcatttacttcgccgccgattg
actaccagcgatcgggatgacaaggggcgccagagtctagcgctgcgcgctgagaaactg
gcatcaaatttgacagggatcgaagaggagcaggactccgatggcattgcgggccattct
atcgattcaactccaccacttagcgaagcccccactcagcaaccctccgccgtcatgcaa
aagtcaccccaagccgatctacgtcgcgttgcttcagaatctataacaggtaggaacaca
gctcactcgatggagcagaatgcccttgatatgaatttatctggagtcttaaaggaagat
atggttaaaggcggtcccgtacattacatacttccgaagtctcaatttttcgagtggaaa
agggactctttcgacataaactttgagtttgtagatgatgatactccagctgatacagac
cctctcaaaatgctttacgaacaagaaagcgaggatgctttgctagcagtagaagaagaa
gccactttgaaaaagggcgagctggagctacaagaaaacatgcttttacgcaacgaagga
gtcaagatgacgtctatggttcggtttcatgcttatgaagatgtactgatggcttgcggc
gcgtcagatgccgtttcaatgtggtgcacaaactccggcaaacagcttacgaaatttctc
aatagcaaaacaaaaaaggctcgattgactacatcggcttggatcaatgaacacgcatcc
agtcttttcatggttggcggcgacactggcaacgttcacgtgtggggcaacctccttgag
agcaacggagaggcatgcagaacacctgccaagttgatctcagcctttcaagccgctccc
atgacagcgggacaacgcggtagtggactcatttgcgaatggcaatcgtacagtgggaca
ttgttggctggtggcagcagcaagactctgcgctgctgggatctagaatcggaaaaactt
tctaatcaatttgagaccaacacagacgcaaacctgacaactttgacgactgcttgggat
tacgatgaacttggaatggggcccgggcctaaaggatatcaaggcattggacaggatatc
gttgtcggcggttttagcgatggagctttgaggatatttgatattcgcaccaaccaggca
ggcagtagcttgcagtctagccaacctacacgacctcgccgaaagagagctactgagttt
tctgaacacaagacttgggtcgtttcgacttcgttcactgcgtatggaaaccgttacgag
ctcatttcgggaacaatatccggggaaataaagatttgggacttacgtatgtcttcaagt
attcgaacatttgctgcacagagaagcaccatgacgagctttgcggtccactcgaagatt
ccaatactggccactggatcgcacgctcagttcattaagttattgactctggacggcgac
gcattccaggtcatgcggtaccacggcaaaatggcgagtcaccggatcggaccggtgagc
tgccttgcattccatcgtttcaaacccatgcttgcggctggagcgacggacgcttacatt
ggactctacactaccaagaaaagattcatttaa

DBGET integrated database retrieval system