KEGG   Phaeodactylum tricornutum: PHATR_18549Help
Entry
PHATR_18549       CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K07204  regulatory associated protein of mTOR
Organism
pti  Phaeodactylum tricornutum
Pathway
pti04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:pti00001]
 Cellular Processes
  Transport and catabolism
   04136 Autophagy - other eukaryotes
    PHATR_18549
Membrane trafficking [BR:pti04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    PHATR_18549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Raptor_N HEAT_2 HEAT Peptidase_C14 DUF446
Motif
Other DBs
NCBI-GeneID: 7204174
NCBI-ProteinID: XP_002186361
JGI: 18549
UniProt: B5Y4V4
Position
3
AA seq 1250 aa AA seqDB search
MDPPDVVDKPHPCAVLHTWIDPNAERAATAREKIGERLEQQYSKWQTASTAWPLRKRRTV
DPTMEDVRSLCQHLRRHARNERVLFHYHGHGVPRPTHNGEIWAFDAKRTEYIALSVADVR
TWLGKPSIVVLDCSSAGVLVPFFTAPMADPSVAPSSTPSRAQTEPTNLREQASEWVSDTV
VLCPCSEGEWLPMNPDYPVDIFTSCLTTPLKIALRWFIQRNPVSMASLHPDAVDHIPGVF
NDRKTPLGELNWIFAAVTDSIAWNVLPKPLFQRLFRHDLLMSSMFRNFLLADRVLRSMGC
TPVSYPPLPPGISNHQLWQSWDLACETMLVQLMNDGTSRHPTNHTVSVSSPFFSEQLTAF
EVWLEFTSIHKMQLKLGMLEPPEPLPMVLQVLLSQTHRIRALHLLRRFLEFGPWAVNLSL
ILGIFPYVSKLLQSPDYKSLLVGIWASILAFDPSCRVDMLKNGILHHFVQYLTLDPDAYG
SVKEAKAARERTLAAFDLSITCCGYPMGQSECVRLRLHNHFCALFSAYEKTEKCQYDDME
LYLPARFRLWLCICIANMMKDNNATQAEAYNAGVHSRLFVRMSDQDPDVRAAVCYALGCL
LGTSAKNEQTGKNLLTIEVLLKAVEDASVVVRYEATLGLARAVGKYLDAFVSVASTAASN
EDRNMYVSLPPAVDLKTGDRFALVWSILRLLQHNDPFPFIAKAANDIVCVVFEHLLRRRL
TTSDRDDKGRQSLALRAEKLASNLTGIEEEQDSDGIAGHSIDSTPPLSEAPTQQPSAVMQ
KSPQADLRRVASESITGRNTAHSMEQNALDMNLSGVLKEDMVKGGPVHYILPKSQFFEWK
RDSFDINFEFVDDDTPADTDPLKMLYEQESEDALLAVEEEATLKKGELELQENMLLRNEG
VKMTSMVRFHAYEDVLMACGASDAVSMWCTNSGKQLTKFLNSKTKKARLTTSAWINEHAS
SLFMVGGDTGNVHVWGNLLESNGEACRTPAKLISAFQAAPMTAGQRGSGLICEWQSYSGT
LLAGGSSKTLRCWDLESEKLSNQFETNTDANLTTLTTAWDYDELGMGPGPKGYQGIGQDI
VVGGFSDGALRIFDIRTNQAGSSLQSSQPTRPRRKRATEFSEHKTWVVSTSFTAYGNRYE
LISGTISGEIKIWDLRMSSSIRTFAAQRSTMTSFAVHSKIPILATGSHAQFIKLLTLDGD
AFQVMRYHGKMASHRIGPVSCLAFHRFKPMLAAGATDAYIGLYTTKKRFI
NT seq 3753 nt NT seq  +upstreamnt  +downstreamnt
atggatcctccagatgttgtggataaacctcatccctgtgcagtgcttcatacttggatc
gaccccaacgccgaacgtgcggccacggcacgcgaaaaaatcggagaacgccttgagcaa
cagtattccaagtggcagacagccagcacggcctggccgttgcgcaaacgacggacggta
gatccgaccatggaagatgtacggagcctttgccagcatctccgtcgacacgcccggaac
gagagagtcttgtttcattaccacggacatggtgtgccgagaccaacccacaacggagaa
atatgggcgttcgacgccaagcgtacagaatacattgccttatcggttgcagatgttcgc
acgtggctgggaaaacccagtattgttgttttggactgttcctccgctggcgtgctagtg
cctttctttacggcgccaatggccgatccttcggttgcaccctcctcgacaccatcgcga
gctcagaccgaaccgacaaatctcagggaacaagcatcggagtgggttagcgacacagtc
gtactatgtccttgctctgaaggcgaatggctacccatgaacccagactatcccgtcgac
atttttacgtcgtgtttaaccactccactcaagattgctcttcggtggttcattcaaagg
aaccccgtcagcatggcttcccttcaccccgatgcagtagatcacattcctggtgttttc
aacgatcgaaaaactccactcggagaattgaattggatatttgccgccgtaacggactca
attgcttggaacgtactgcccaaaccgctatttcagcgactttttcgtcacgacttgctg
atgtccagtatgtttcgtaactttttattggctgaccgagttctgcgatcgatgggttgc
accccggtatcctatcctccgttgccaccgggcatttcgaatcatcaactgtggcaatct
tgggacttggcctgtgaaacaatgttggtgcagctcatgaatgacggaacttccaggcac
cccaccaatcacacagtgagtgtctcatcaccgtttttctcagagcaattgacagctttt
gaagtatggctagaatttacgtcaatccataagatgcagttgaaactcggaatgctggag
ccacccgaaccgctgccaatggtactacaggtcctacttagtcagacacaccgtattcgt
gcgttgcacctccttcggcggtttttagaatttggcccatgggcagttaacctgtcactc
attctgggaatttttccctacgtgtcgaaattgctgcaatctcctgactacaagagctta
ttggttggtatttgggcatctatcttggctttcgacccttcttgtcgcgttgacatgctg
aaaaacggaattcttcaccactttgtccagtatttgacattggacccggatgcatatggt
tcagttaaagaagccaaagccgctcgggagcgaaccttggctgcgttcgacttgtccatt
acttgctgtggttaccctatggggcagtccgaatgtgttcgacttcgcctccataatcat
ttctgcgcgctcttttctgcttacgaaaaaacagaaaaatgtcagtatgacgatatggaa
ctttatttgccagcgcgctttcgactttggttatgtatttgcatcgcgaatatgatgaaa
gacaacaatgcaacgcaggctgaagcgtacaacgctggtgtacattcacgcctatttgtg
cgaatgagtgaccaagatccggacgtgcgagccgcagtttgctatgctcttggttgcctc
ctcggtacttccgcgaaaaatgaacaaacagggaaaaatttgttaacgattgaggtctta
ttgaaagcagttgaagacgcgagtgttgtagtacggtacgaagctacactcggtctagca
cgagcagttggaaaatatcttgatgcctttgtatccgttgcctccaccgcagcaagcaat
gaagatagaaatatgtatgtttctttgcctcctgccgttgatctcaaaacaggcgatcgt
tttgcactggtttggagcatcttgcggttattgcagcacaatgacccctttcctttcatt
gctaaggcggcaaacgatatcgtgtgcgtagtctttgagcatttacttcgccgccgattg
actaccagcgatcgggatgacaaggggcgccagagtctagcgctgcgcgctgagaaactg
gcatcaaatttgacagggatcgaagaggagcaggactccgatggcattgcgggccattct
atcgattcaactccaccacttagcgaagcccccactcagcaaccctccgccgtcatgcaa
aagtcaccccaagccgatctacgtcgcgttgcttcagaatctataacaggtaggaacaca
gctcactcgatggagcagaatgcccttgatatgaatttatctggagtcttaaaggaagat
atggttaaaggcggtcccgtacattacatacttccgaagtctcaatttttcgagtggaaa
agggactctttcgacataaactttgagtttgtagatgatgatactccagctgatacagac
cctctcaaaatgctttacgaacaagaaagcgaggatgctttgctagcagtagaagaagaa
gccactttgaaaaagggcgagctggagctacaagaaaacatgcttttacgcaacgaagga
gtcaagatgacgtctatggttcggtttcatgcttatgaagatgtactgatggcttgcggc
gcgtcagatgccgtttcaatgtggtgcacaaactccggcaaacagcttacgaaatttctc
aatagcaaaacaaaaaaggctcgattgactacatcggcttggatcaatgaacacgcatcc
agtcttttcatggttggcggcgacactggcaacgttcacgtgtggggcaacctccttgag
agcaacggagaggcatgcagaacacctgccaagttgatctcagcctttcaagccgctccc
atgacagcgggacaacgcggtagtggactcatttgcgaatggcaatcgtacagtgggaca
ttgttggctggtggcagcagcaagactctgcgctgctgggatctagaatcggaaaaactt
tctaatcaatttgagaccaacacagacgcaaacctgacaactttgacgactgcttgggat
tacgatgaacttggaatggggcccgggcctaaaggatatcaaggcattggacaggatatc
gttgtcggcggttttagcgatggagctttgaggatatttgatattcgcaccaaccaggca
ggcagtagcttgcagtctagccaacctacacgacctcgccgaaagagagctactgagttt
tctgaacacaagacttgggtcgtttcgacttcgttcactgcgtatggaaaccgttacgag
ctcatttcgggaacaatatccggggaaataaagatttgggacttacgtatgtcttcaagt
attcgaacatttgctgcacagagaagcaccatgacgagctttgcggtccactcgaagatt
ccaatactggccactggatcgcacgctcagttcattaagttattgactctggacggcgac
gcattccaggtcatgcggtaccacggcaaaatggcgagtcaccggatcggaccggtgagc
tgccttgcattccatcgtttcaaacccatgcttgcggctggagcgacggacgcttacatt
ggactctacactaccaagaaaagattcatttaa

DBGET integrated database retrieval system