KEGG   Phaeodactylum tricornutum: PHATR_20948Help
Entry
PHATR_20948       CDS       T01075                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
pti  Phaeodactylum tricornutum
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PHATR_20948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11
AA seq 104 aa AA seqDB search
MSEKKGAKIFKTKCSQCHTVEEGGSHKQGPNLYGFFGRQSGQADGYSYSAANKKSGITWG
EDTLFEYLENPKKYIKGTKMIFAGLKKEKDRKDLIAYLKSTCTA
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaagaagggagccaagattttcaaaaccaagtgttcgcagtgccacactgtg
gaagagggtggctcgcacaagcaaggacccaatctgtacggtttcttcggccgacagtct
ggacaagccgacggatactcctattccgctgccaacaagaaatccggtattacctggggg
gaagatacgctgtttgagtacttggagaatcccaaaaagtacatcaagggcaccaaaatg
atctttgccggactcaagaaggaaaaggaccgcaaggaccttattgcctacctcaagtcc
acttgcactgcttag

DBGET integrated database retrieval system