KEGG   Phaeodactylum tricornutum: PHATR_20948Help
Entry
PHATR_20948       CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
pti  Phaeodactylum tricornutum
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 7204578
NCBI-ProteinID: XP_002185820
JGI: 20948
UniProt: B5Y3C2
Position
11
AA seq 104 aa AA seqDB search
MSEKKGAKIFKTKCSQCHTVEEGGSHKQGPNLYGFFGRQSGQADGYSYSAANKKSGITWG
EDTLFEYLENPKKYIKGTKMIFAGLKKEKDRKDLIAYLKSTCTA
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaagaagggagccaagattttcaaaaccaagtgttcgcagtgccacactgtg
gaagagggtggctcgcacaagcaaggacccaatctgtacggtttcttcggccgacagtct
ggacaagccgacggatactcctattccgctgccaacaagaaatccggtattacctggggg
gaagatacgctgtttgagtacttggagaatcccaaaaagtacatcaagggcaccaaaatg
atctttgccggactcaagaaggaaaaggaccgcaaggaccttattgcctacctcaagtcc
acttgcactgcttag

DBGET integrated database retrieval system