KEGG   Phaeodactylum tricornutum: PHATR_2957Help
Entry
PHATR_2957        CDS       T01075                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PHATR_2957
Transcription machinery [BR:pti03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PHATR_2957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11
AA seq 338 aa AA seqDB search
LRWIVVRNDGEPDSMIKLVGLKSLFSKQLPKMPRAYIARLVFDRRHTSLAILNDNPDVKD
SDEEIIGGICYRAFPEMRFAEIAFCAVNASHQVKGYGTKLMNLLKKIGAETGIEYFITYA
DNYAIGYFKKQGFAKNISMPKGRYFGLIKDYDGGTPMECYVHPSIDFTRVPEMLQAQRNF
ILAQVSRVAKSRIVYEPLSLSRSNQAAARALAIPGIAQAGWTLADLTTASGQGKEADRQK
SALKTTLLAMLRKIEEQQFAWPFREPVDLTEVPDYLQVVTTPIDLSTMEKRIRADLYRSK
QMAFADLMLMVNNCKLYNDDGSPYMECATSLERYVKNL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
cttcgatggatcgtggttcgcaacgacggggaacccgattccatgattaaactcgttggt
ctcaaatcgctcttttcgaagcagttacccaaaatgccgcgggcatatattgcccgtctt
gtgtttgaccgccgtcatacatccttggctattctcaacgataatcccgacgtgaaagat
tccgacgaagaaattattggcggtatttgctaccgtgcttttccggaaatgcgttttgcc
gaaattgctttttgtgccgttaatgcgtcccatcaagtcaaaggatacggcaccaagctt
atgaacttgctcaaaaagattggcgccgaaaccggaatcgaatatttcattacgtacgcc
gacaactacgccattggctacttcaaaaagcaagggtttgccaagaatatttccatgccc
aagggtcgatactttggcctaatcaaggactatgacggtggcacaccgatggaatgctac
gtccatccctctattgattttacccgcgttccggaaatgctgcaggcgcaacggaatttt
attctcgcgcaagtgagtcgcgtcgccaagagccggatcgtgtacgagccgttgtcctta
tcacggtccaatcaagcggccgcccgcgcgttggccattcccgggattgcccaggccggt
tggacgttggccgatttgaccaccgccagtggacaaggcaaggaagcggatcgtcagaag
agtgccctcaaaactacgctgttggcaatgttacggaaaattgaagagcagcaatttgcg
tggcctttccgggagcccgtagatctgacggaagttccggattatttgcaagtcgtgacg
accccgattgacttgtcgacaatggaaaagcggatccgggccgatctgtaccggtccaag
caaatggcgtttgccgatctaatgctcatggtgaacaactgcaaattatacaatgacgac
ggaagcccgtatatggagtgtgcgactagtttggaacgatacgtgaagaatctc

DBGET integrated database retrieval system