KEGG   Phaeodactylum tricornutum: PHATR_3692Help
Entry
PHATR_3692        CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
pti  Phaeodactylum tricornutum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pti00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PHATR_3692
Enzymes [BR:pti01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PHATR_3692
Peptidases [BR:pti01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PHATR_3692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 347 aa AA seqDB search
PGSVGLHNLGNSCFLNATIQCLNHIEPLTQYFLQGKYLDELNRNNPLGSGGNVAMSYASL
LKKMWGGEYSTLVPRLLKQTVASFAPQFDNCYQHDSQEFGQFLMDGLHEDLNRVQTKPYV
EELEGLGMPDDQAAIESWRKHLLRHDSIIVDHCQGMHRSHLTCPRCGRESIKFDIFSSIS
VPLACTKQKSAIQLQDCLEKFMEGEQLDERNAWYCPKCRQHVCALKMIALWTIPDILIIH
LKRFTFDTCMASGHMLRSKVDDKVEFPIEGLDLTKYILGPVDPDAPPVYRLFGVSEHTGP
TANSGHYTATVRNSIDGQWYRCNDSHVGRTSGEASITGGAYVLFYQR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
cctggatcggttggtttacataatcttggtaactcgtgctttctcaacgcaaccatacaa
tgtctgaaccacattgaaccactaacgcagtactttttgcaaggaaaatacttggatgaa
ctaaaccgaaataaccctctgggtagtggcggtaacgtcgccatgtcgtacgcatcgctt
ttgaaaaagatgtggggtggagaatattctacattggttccacggctcttgaagcaaacc
gtcgcgtcgtttgctcctcagtttgacaactgctatcagcatgacagtcaagaattcggt
cagttcctaatggatggcttgcacgaggatctgaatcgtgtgcaaacgaagccttatgtg
gaagagttagaggggcttgggatgccagacgaccaagcagcaatcgagtcttggcgcaag
cacctacttcggcacgacagtatcatagtggaccattgtcagggcatgcaccgaagccat
ttgacttgcccaaggtgtggtcgcgagtcaataaaatttgacattttttcatctatttcg
gttcctttggcgtgtaccaaacagaaatcagcgatacaattgcaagattgtctcgaaaaa
tttatggaaggcgaacaacttgacgaaaggaatgcgtggtactgtccaaagtgtagacaa
catgtgtgtgctttgaagatgattgctctctggaccataccagatattctcattattcat
ttgaaacgcttcacgtttgacacttgcatggcttctggacatatgctccgctcaaaagtg
gacgacaaagtcgaatttcccatcgaaggtcttgatctgacaaaatacatacttggaccc
gttgatccagatgcaccgcctgtatatcgccttttcggggtgtcagaacatacgggaccg
accgccaactctggccattacaccgccactgtgcgaaattctattgacggtcagtggtat
aggtgtaatgattctcatgtgggccgaacgtcaggtgaagcgtcaataacgggtggtgcg
tacgtcttattctaccagcga

DBGET integrated database retrieval system