KEGG   Phaeodactylum tricornutum: PHATR_52135Help
Entry
PHATR_52135       CDS       T01075                                 

Definition
silent information regulator protein Sir2
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     PHATR_52135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11
AA seq 307 aa AA seqDB search
MSAGYASRLKEYPHKGVCGLPEKQDTPRQLKSKLARLVELMQPTDRPRRIVIVTGAGIST
AAGIPDFRGPSGIWTLEKKKTTMDFAAAQPTLTHRAITYLTQQKGVVRFVVTQNVDGLHR
RSGLSRDHHAVLHGCVFTERCNHCGREYFRDKDVGGMSFHPTGRLCDVPCVGKENSKGIL
VDTLLDWEDALPEDDLDRATTECETADLVLCLGTSLRIEPAGSLPTLAKDYVIVNLQVTP
KDEEASLIIRAKADIVMTHLLEALGFVDWEKDMAQNPPTIERVWLPPAPAKPVTNVYSCR
SRRSTSQ
NT seq 923 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctggatacgcgtcacgtttgaaggaatacccgcacaagggtgtttgcgggctg
ccggaaaagcaggatacaccgcgtcagctcaaaagcaagcttgcacggctggtggaattg
atgcaaccgacggatcgccctcgacgaatcgtgatcgtaaccggcgcgggaatcagtacg
gcggcgggaattccggattttcgaggaccgtcgggaatttggactttggaaaagaaaaag
actacaatggatttcgccgcggcgcaacccacactcacgcaccgggccattacgtacttg
acccaacagaaaggcgttgttcgctttgtggtgacccagaacgtggacggcttgcaccgt
cgatcgggtttgtcgcgagatcatcacgcagttctacatggttgcgtctttacggaacga
tgtaatcattgtggccgtgaatactttcgagacaaagatgtgggtggaatgagttttcac
cctacggggcgactctgcgatgtcccgtgtgtaggcaaagagaacagcaagggaattttg
gtggacacgcttctggattgggaagatgcattaccggaagatgacttggatcgggcgacg
acagagtgtgagactgctgatttggttctatgcttgggaacatccctacgaattgagccg
gccggcagtttgccaacgctggccaaagactatgtcattgtgaatctgcaagtcacgccc
aaagacgaggaagcaagtttgatcatacgagccaaagctgacattgttatgactcactta
ctggaggcgttgggattcgtggactgggagaaagacatggcccagaaccctcccactatt
gagcgtgtatggctgccacctgcacccgcaaagccagtaaccaatgtgtactcctgccgc
tcacggcggagcacaagtcaatg

DBGET integrated database retrieval system