KEGG   Paramecium tetraurelia: GSPATT00000190001Help
Entry
GSPATT00000190001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     GSPATT00000190001
Protein kinases [BR:ptm01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   GSPATT00000190001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 323 aa AA seqDB search
MDQATFKAIKVKLTDYEILQTLGTGSFGRVRLAKNKETGEYVALKMLKKAEILRLKQVDH
IISENTILSNISHPFLIKMLGFTQDERYLYFLLEYVQGGELFTYLRNKGKLENDEAVFYA
SQVVLMFEYLHSKNIVYRDLKPENLLIGSDGYLKLTDFGFAKQVEGRTYTLCGTPEYLAP
EILLNKGHGKPVDWWCLGILIYEMLAGIDPFNDEDPMAIYQKILKGKVKFPRNFQQEAKS
LVKHLLIADLTKRFGNLKGGANDIKMHRWFQAMDWEFLVQKKLQPKYKPVVKNKGDTSNY
STYPDSTELPKPVKPTDDPFIGW
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggattaggcaacatttaaggcaataaaagtgaaacttacagattatgaaattttgtaa
actctgggcactggttcgtttggcagagtcagattggctaagaacaaagaaactggggag
tatgtcgcattgaaaatgttgaagaaagccgagattttgcgattaaaataggtagatcac
attatatctgaaaatacaatcttgtctaatataagtcatcccttcctaattaaaatgtta
ggatttacataggatgaaagatatctctatttccttctggagtatgttcaaggtggtgaa
ctcttcacttacttaagaaacaagggcaaattggagaatgatgaagcagtattttatgcg
tctcaagttgttcttatgtttgaatatttacattccaaaaatattgtttatagagatctt
aagccagagaatctcttgattggatctgatggttatctcaaattaaccgatttcggattt
gcaaaataagttgaaggtcgaacctacactttatgtggcactccagaatatctggctcct
gaaattcttctcaacaaaggtcatggaaaaccagttgattggtggtgtttgggaatcttg
atttatgaaatgttggctggaatagatcctttcaatgatgaagatcctatggctatttac
cagaagatattaaaggggaaagttaaatttcccagaaatttttaacaagaggccaaaagt
ttagtcaagcatttgttaattgcagatttgactaaaagattcggaaatctcaaaggagga
gccaatgatatcaaaatgcaccgctggttttaggctatggattgggagtttctagttcaa
aaaaaattataacccaaatataagccagtagttaagaacaagggggatacctctaattat
tctacttatcctgacagtactgagttacctaaaccagttaaacctactgatgaccctttt
attggatggtga

DBGET integrated database retrieval system