KEGG   Paramecium tetraurelia: GSPATT00000284001Help
Entry
GSPATT00000284001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ptm  Paramecium tetraurelia
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ptm00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 588 aa AA seqDB search
MCGILAIFNIKGTYIEVRTLAYNLSKRQRHRGPDRSRIIILKAGPDTYHILAHERLNIVD
LSDRGRQPFQLVDDQNVYYMQNGELYNYWSIKPEFEKKYKFSSNSDSEIVGMLYKEYGPN
DFWNHMDGMHATIVLDMNNQTYYAGRDHIGIIPLYYGYNKDGALFLSSELKGIHDQVVEV
KQFPPGHYIDQTNEIKKWYNPLWHNFDHIPTGEINFQEMRDRFIDVVRREVKGDAPFGLF
ISGGVDSSIVAGIVAKLIKNGEIDLSKRGMRKVHSFCIGLEGSPDLHFARKVAEYHGFEH
HSFTYTVEEGLDYIPEVIYHTETFNNTTIRASTPMYMMCRRIKALGIKICLTGEGSDELF
GGYLYFHKAPNRVEFHQELIRKLNDLHKYDLLRANKACLAWGIETRPPFMNKAWIEYVMS
IDPKYKMINAFQPQIEKYILRKAFEDLENPFVPQEILWRQKEQFSDGVGYSWRDGLIERA
NQLVSDQEFAQASTTYPVSTPRDKEQYWFRQVYSSAFPSDSSALTVPYGKSIACSTEKAL
EWDEAFKKNTDESGRAVLSIHNDALKEILQEEDKITDESIKVQDHFQL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattttggcaattttcaacattaaaggaacttatattgaagttcgaactctc
gcttacaatttatcaaagagacaaagacatagaggtcctgatagatctcgtatcataata
ttgaaagcaggcccagatacttatcatatcctagctcatgaaagattgaacatcgtagat
ttaagtgatagaggaagacaaccattctaattagttgatgattaaaatgtctactacatg
taaaatggagagctctacaattattggtcaatcaagccagaattcgaaaaaaaatacaaa
tttagcagcaattctgattccgagatcgtgggaatgctctataaagaatatggtccaaat
gatttttggaatcacatggatggaatgcatgctacaattgtcttggatatgaacaaccag
acttattatgcaggaagagatcatattggaattattcctttgtattatggatacaacaaa
gacggagccttgtttttatcatcagaattaaagggaattcatgattaagtggttgaagtt
aaataattccctccaggtcattatattgatcaaactaatgaaattaagaaatggtacaac
ccactttggcataattttgatcatattccaacaggagaaatcaatttttaggaaatgaga
gatagatttattgatgttgtaagaagagaagttaaaggagatgcaccatttggtctattt
atatcaggaggagttgattcatcaattgttgctggtattgttgcaaagttgattaaaaat
ggtgagattgatttgagcaagagaggaatgagaaaggttcattctttttgtattggtttg
gaaggatccccagacttacattttgcaaggaaagtagctgaatatcatggatttgaacat
cattcattcacctatacagttgaggagggtttagattatataccagaagtcatctaccac
acagagacatttaataacactactattcgagcatcaacacctatgtatatgatgtgtaga
agaattaaagcattgggaattaaaatatgtttaactggagaaggaagtgatgaattattt
ggaggttatttatatttccacaaagctccaaacagagttgaattccattaagaattaatt
agaaaacttaatgatttacataaatatgatctcttaagagctaacaaagcctgtttagca
tggggtattgaaactagaccaccatttatgaacaaggcttggattgaatatgttatgtct
attgatccaaaatacaaaatgatcaatgccttccaaccataaattgagaaatatatatta
agaaaagcctttgaagatctagaaaatccgtttgttccataagaaatattatggagataa
aaggaacaattcagtgatggagttggttacagttggagagatggacttatcgaaagggct
aatcaattagtctcagattaagaattcgctcaagcctcaaccacttatcccgtatcaacc
cctagagataaggaataatattggttcagataagtttattcttctgcctttcctagtgat
agttctgccttgacagtaccatatggcaagtctatagcttgctctaccgaaaaagctttg
gaatgggatgaggctttcaagaaaaataccgatgagtctggaagggcagtcttatcaata
cacaatgatgcactcaaggaaatcctacaagaagaagacaaaattacagatgaaagcatc
aaagtataggatcacttttaactgtga

DBGET integrated database retrieval system