KEGG   Paramecium tetraurelia: GSPATT00000745001Help
Entry
GSPATT00000745001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
ptm  Paramecium tetraurelia
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ptm00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 116 aa AA seqDB search
MSQSRFDVNEQVQIPNGDAKRGQQMFEFKCGACHNFEDDKQELAAPTLKKIMGKRIGSTL
FHYSKSMRNCNETWTEKNMFLFLKDPKAYFRDTKMAQTKIANPQERADIIQFLKSL
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtcttaatcgagatttgatgttaatgaataggtttagattcctaatggcgatgcaaaa
aggggatagcagatgtttgagtttaagtgtggtgcttgtcacaattttgaagatgataaa
taagaattagctgcaccaacattaaaaaaaattatggggaaaagaataggatcaactctg
tttcattactctaaatcaatgagaaattgtaatgagacttggactgaaaaaaacatgttt
ctatttcttaaagatccaaaagcttattttagagatactaaaatggcataaacaaagatt
gctaatccttaagaaagagcagatattattcaattcttgaagagtttgtga

DBGET integrated database retrieval system