KEGG   Paramecium tetraurelia: GSPATT00000745001Help
Entry
GSPATT00000745001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
ptm  Paramecium tetraurelia
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 zinc_ribbon_12 Cytochrome_C7
Motif
Other DBs
NCBI-GeneID: 5024215
NCBI-ProteinID: XP_001438430
Genoscope: GSPATT00000745001
UniProt: A0CJR6
Position
undetermined
AA seq 116 aa AA seqDB search
MSQSRFDVNEQVQIPNGDAKRGQQMFEFKCGACHNFEDDKQELAAPTLKKIMGKRIGSTL
FHYSKSMRNCNETWTEKNMFLFLKDPKAYFRDTKMAQTKIANPQERADIIQFLKSL
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtcttaatcgagatttgatgttaatgaataggtttagattcctaatggcgatgcaaaa
aggggatagcagatgtttgagtttaagtgtggtgcttgtcacaattttgaagatgataaa
taagaattagctgcaccaacattaaaaaaaattatggggaaaagaataggatcaactctg
tttcattactctaaatcaatgagaaattgtaatgagacttggactgaaaaaaacatgttt
ctatttcttaaagatccaaaagcttattttagagatactaaaatggcataaacaaagatt
gctaatccttaagaaagagcagatattattcaattcttgaagagtttgtga

DBGET integrated database retrieval system