KEGG   Paramecium tetraurelia: GSPATT00000950001Help
Entry
GSPATT00000950001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ptm  Paramecium tetraurelia
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    GSPATT00000950001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     GSPATT00000950001
Protein kinases [BR:ptm01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   GSPATT00000950001
Mitochondrial biogenesis [BR:ptm03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    GSPATT00000950001
  Mitophagy factors
   Other mitophagy factors
    GSPATT00000950001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 560 aa AA seqDB search
MTEQQQLNNHGNRTRMIGNYVIGKTLGFGTFGKVKMGIHEQSQEKVAIKILEKDRIVETA
DVERVQREIHILKLVRHPHIIQLYEIIETPKHIFLVMEMISGGELFDYIVQNTKLEEVEA
CKLFQELIAGIEYLHKLRVVHRDLKPENLLLDHHKNLKIVDYGLSNTYKSEELLKTACGS
PCYAAPEMIEGQKYQGVKVDLWSSGVILFACLCGYLPFEDQNTSALYKKILSGSYQLPSH
LSKEAQSMIQGILTVKPDKRFTINDIRNHPWFKIYRRTYEIPPGIVVGYNRIPIDQEILK
QLKQYGIDIDHAQKCLDANKHNEITTFYHLLLKRHLTNGGRSTADLNSESFDITLLEPKQ
RPQKAPISSLVNNEVIKQQMKDEIIKQRSYSTDKDRGRIIKTTNQNKILADNDLSVNRIG
NNGQAQSVQARQKDENYFEQSPVIKNNKVPYSNMLCQKYGIKFKNNNVTSIDYHNKDDIK
KGSSRNKREIDIMNPYRNSSREQQQLNRMLQSGGRSQNSKKERAYITSHNNQSFDVPLNS
NQSNKQKAINQQRSGHFHHD
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgacggaatagtaataattaaataaccatggcaatcgaacaagaatgattgggaattat
gtaataggcaaaactctgggatttggaacgtttgggaaggtcaaaatgggtattcatgag
caatcacaagagaaagtggcaattaaaatattggagaaggatagaatagtagaaactgca
gatgtagaaagagtacagagagagattcatatcttaaagttagttagacatcctcatata
atctaactatatgagattattgaaacaccaaagcacatattcttagtaatggaaatgatt
agtggtggcgaattatttgattacatcgtctagaatacaaaattggaagaagttgaggca
tgtaagttattttaagaactaattgctggaatagaatatctacataagctaagagtagtc
catagagatttaaagccagagaacttgttgcttgatcatcataagaatctcaaaattgtt
gactatggattatccaacacttacaaatcagaagaattattgaagactgcttgtggaagt
ccatgttatgcagctcctgaaatgattgaagggcaaaaatattaaggagtgaaagtcgat
ttgtggagttctggagttatattatttgcatgtttatgtggttatttgccatttgaagat
caaaatacttctgctctttacaaaaagatattaagtggatcgtattaacttccatctcat
ctctctaaggaggcttaatcgatgatccaaggaatcttgacagtcaagccagataaacgc
tttactattaatgatattagaaatcacccttggtttaagatctatagaagaacttatgaa
attcctccaggaattgtagttggatataatagaattccaattgactaagaaatacttaaa
tagttaaaataatacggaatagatatagatcatgcctaaaagtgtttagatgccaataaa
cacaatgaaataacgaccttttatcatttgcttttgaaaaggcatttgacgaatggaggt
cgatcaacagctgaccttaattctgaatcttttgatatcactctattagaacctaagcaa
agaccccaaaaagctccaattagttcattagttaataatgaagtcatcaaacaataaatg
aaagatgaaataattaaataacgatcatattcaactgataaggatagaggtagaattatt
aagacaactaattaaaataaaatattggccgataatgacttaagtgtgaacagaataggt
aataacggataagctcagagtgtataagcaagataaaaagatgaaaactattttgaatag
tcacctgtcatcaaaaataataaagtcccttattccaatatgctgtgtcaaaaatatggc
ataaaattcaagaataataatgtgacatcaattgactatcacaataaggatgacattaag
aaaggcagttctaggaataaaagagaaatagatatcatgaatccttatcgaaactccagc
agagaacaataataattaaatagaatgcttcaaagtggaggaagatcgcaaaatagcaaa
aaagaaagggcttatataactagtcataacaattaatcgtttgatgtacccttgaattca
aatcaatcaaataaacaaaaggcaataaattaataaagatctggtcattttcatcatgat
tga

DBGET integrated database retrieval system