KEGG   Paramecium tetraurelia: GSPATT00001003001Help
Entry
GSPATT00001003001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ptm  Paramecium tetraurelia
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    GSPATT00001003001
Enzymes [BR:ptm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     GSPATT00001003001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 427 aa AA seqDB search
MNKVICLLSLLLATSYALYDSRSKVQLLTPQTFREKVLNSKSLWIVEFFAPWCGHCKALA
PEYEKAAKTLEGIVNIAAVDADAHKDLGGQYGIQGFPTIKFFGENKNSPSDYQGERSAQA
IINFALEQVKSTVNGRQKGSSSNKNQQKQSSGSGSGSGSGSGSADDVIVLTDSNFDENVL
KSKDSWFVEFYAPWCGHCKKLEPEWNKLGSELKGKVKVAKVDATANTQLATRFGVSGYPT
LKFFPAGFSNDSEAISYDGARDSSAMIEYALEQSNKSKKVEVVELLSKDVLTENCIDFNG
VCIIAFLPHIYDSNKQERNQYINQLLEVAKSLKNKPVNFLWTQGGDNYEFEEAFQCAAAH
PSVMALSGRKSVYAKLKGAFSKQNIEQFVNNALNGREHFNQYSRLPNFKKVEKWDGQDHK
PVYNDEF
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagttatctgtcttctttcactattgttggctacttcttatgcactttatgac
tcaagatccaaagtacaactcctaacccctcagactttcagagagaaggtgctaaattct
aaatctctttggatagtggaattctttgctccatggtgtggtcattgcaaagcccttgcc
ccagaatacgaaaaagcagcaaaaacattagaaggaattgtgaatatagctgcagtggat
gcagatgctcacaaagatctcggaggacagtatggtatttaaggattccctacaatcaaa
tttttcggagaaaacaaaaattctccatctgattatcaaggagaaagatcagcataggca
ataatcaactttgcattagaataagtcaaatcgactgtaaatggtaggtaaaaaggtagt
tcttcaaataaaaatcaataaaaataatcctctggttctggatctggctcaggatcagga
tcaggatcagccgatgatgttattgttcttacagattcaaatttcgatgaaaatgttcta
aaatctaaggattcttggtttgttgaattttatgctccttggtgtggtcactgtaagaaa
ctagaaccagaatggaataaattaggatcagaactcaagggaaaggtcaaagtggctaag
gttgatgccactgcaaatacctaattagccactcgtttcggagtttcaggatatccaact
ttgaaattcttccctgcaggtttctctaatgattcagaagcaatctcttatgatggagcc
agagattcttctgcaatgatagagtatgctttagaataatctaacaaatcaaagaaggtg
gaagtagtagagttactatcaaaagatgttttaacagaaaattgcatagatttcaatggt
gtgtgtattattgcttttcttcctcacatttatgatagtaataagtaagagagaaactaa
tatatcaattaattattagaagtggcaaaatctttaaaaaataaaccagtcaatttctta
tggacttaaggaggagataactacgaatttgaagaagcattctaatgtgctgcagctcat
ccttctgttatggctttgagtggtagaaaatctgtttatgctaaactcaaaggtgctttt
agcaaataaaatatcgaataatttgtcaataatgcattaaacggaagagaacacttcaat
caatattctaggcttcctaattttaaaaaggttgaaaaatgggatggataggaccacaaa
ccagtttataatgatgaattttga

DBGET integrated database retrieval system