KEGG   Paramecium tetraurelia: GSPATT00001443001Help
Entry
GSPATT00001443001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ptm  Paramecium tetraurelia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 243 aa AA seqDB search
MDQKFENWLPLESNTILLNKYLANLGVNTDFANFVDIVSFEPEFLIPGSLGALFVYPDSP
AINNYFFEQGDKMFEKPIPHSLYYMKQIAENACGTIALLHILANIPKEYQFIINEESFCP
QFIQNTINMTPEERAEYLKNCKLEVKKKDGSVKSLQDAHKEVAQENLEDPNIELKAGHHF
IAFVWHNGSVIELDGRKKAPIIYADCQQELFLEKVIEICQKHYIEKDLKEIGFNLMAFQI
GFE
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggactaaaagtttgaaaattggttgcccttagaatccaatacaattttattaaataaa
tatttagccaatttaggagtgaatacagattttgcaaattttgtagatattgttagtttt
gaaccagaattcctaataccaggtagtctaggagcattatttgtttaccctgattctcca
gctatcaataattacttttttgaacaaggagataagatgtttgaaaaaccaataccacat
tctctttattacatgaagtaaattgcagaaaatgcatgtggcaccatagcccttttgcat
atactggccaatattccgaaggaatattaattcattattaatgaagagagcttttgccca
taattcatatagaatacaattaatatgacacctgaagaaagggcagaatatttgaaaaac
tgcaaattagaagtcaaaaaaaaagatggttcagtaaaatcattataagatgcccataaa
gaagtggctcaggaaaatctagaggatccaaatattgaactgaaagctggccatcatttc
attgcatttgtgtggcacaatggaagtgttatagaattagatggaagaaaaaaagcacca
attatttatgctgattgttaataggaattgtttttggaaaaagtcatagaaatctgtcaa
aaacattacattgaaaaggatttgaaagaaattggatttaatttaatggccttttagata
ggatttgaatga

DBGET integrated database retrieval system