KEGG   Paramecium tetraurelia: GSPATT00001443001Help
Entry
GSPATT00001443001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     GSPATT00001443001
Peptidases [BR:ptm01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   GSPATT00001443001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 243 aa AA seqDB search
MDQKFENWLPLESNTILLNKYLANLGVNTDFANFVDIVSFEPEFLIPGSLGALFVYPDSP
AINNYFFEQGDKMFEKPIPHSLYYMKQIAENACGTIALLHILANIPKEYQFIINEESFCP
QFIQNTINMTPEERAEYLKNCKLEVKKKDGSVKSLQDAHKEVAQENLEDPNIELKAGHHF
IAFVWHNGSVIELDGRKKAPIIYADCQQELFLEKVIEICQKHYIEKDLKEIGFNLMAFQI
GFE
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggactaaaagtttgaaaattggttgcccttagaatccaatacaattttattaaataaa
tatttagccaatttaggagtgaatacagattttgcaaattttgtagatattgttagtttt
gaaccagaattcctaataccaggtagtctaggagcattatttgtttaccctgattctcca
gctatcaataattacttttttgaacaaggagataagatgtttgaaaaaccaataccacat
tctctttattacatgaagtaaattgcagaaaatgcatgtggcaccatagcccttttgcat
atactggccaatattccgaaggaatattaattcattattaatgaagagagcttttgccca
taattcatatagaatacaattaatatgacacctgaagaaagggcagaatatttgaaaaac
tgcaaattagaagtcaaaaaaaaagatggttcagtaaaatcattataagatgcccataaa
gaagtggctcaggaaaatctagaggatccaaatattgaactgaaagctggccatcatttc
attgcatttgtgtggcacaatggaagtgttatagaattagatggaagaaaaaaagcacca
attatttatgctgattgttaataggaattgtttttggaaaaagtcatagaaatctgtcaa
aaacattacattgaaaaggatttgaaagaaattggatttaatttaatggccttttagata
ggatttgaatga

DBGET integrated database retrieval system